DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and mfap4.3

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_001339903.1 Gene:mfap4.3 / 100007474 ZFINID:ZDB-GENE-110408-14 Length:242 Species:Danio rerio


Alignment Length:230 Identity:80/230 - (34%)
Similarity:118/230 - (51%) Gaps:16/230 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 ALATPPDDTPRNCYD-EKHGQVR---IRIAPDME-PFFASCDQKVRD------GGWMVIAYRFDG 165
            |||:.....|.:|.| .|.|:..   ..|.|..| |.:..| |.:.|      |||.||..|.||
Zfish    14 ALASDCTSMPFDCSDIYKSGETLSGVYTIYPAGETPVWVYC-QMLSDGKDEENGGWTVIQRRMDG 77

  Fly   166 SEDFNKDWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSES 230
            |.:|.:.|::||.|||.:..|:::||:.|::||..:...|.:.::...|...||.|..||:|.|.
Zfish    78 SVNFYRPWRDYKRGFGNVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSFSVGCEC 142

  Fly   231 EKYLLYVLGAYKGDAGDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQ 295
            |.|.|.|.|...|.|||||..|.|.||:|||:|.|...:|||:...|.:||. .|..:|....: 
Zfish   143 EGYKLQVSGFTDGGAGDSLSPHNGMKFSTFDKDQDTYEKNCAKEFLGGFWYS-SCHNTNPNAVY- 205

  Fly   296 SKYGQEIGYFK-GILWKSFLPGPTGSLSYVRMLIR 329
             .:.:::.:.. |:.|.|:......|:..:.|.|:
Zfish   206 -LWEEDVTHHAIGVSWYSWKGTHAVSMKTISMKIK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 77/223 (35%)
mfap4.3XP_001339903.1 FReD 23..239 CDD:238040 76/219 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.