DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1791 and mfap4.12

DIOPT Version :9

Sequence 1:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_001339837.3 Gene:mfap4.12 / 100007462 ZFINID:ZDB-GENE-110408-35 Length:247 Species:Danio rerio


Alignment Length:206 Identity:79/206 - (38%)
Similarity:117/206 - (56%) Gaps:18/206 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 DDTPRNCYD-EKHGQV-----RIRIAPDMEPFFASCDQKVRD------GGWMVIAYRFDGSEDFN 170
            :|:|.:|.: .|.|:.     .|..|.| .|.:..| |.|.|      |||.||..|.|||.:|.
Zfish    25 EDSPVDCSELNKAGETLSGVYTIHPAGD-APVWVYC-QMVSDGKDEENGGWTVIQRRMDGSVNFY 87

  Fly   171 KDWQNYKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLL 235
            :.|::||.|||.|..|:::||:.|::||..:.|.|.:.::...|.:.||.|..||:|.|::.|.|
Zfish    88 RPWRDYKRGFGNLEGEYWLGLENLYQLTRHKDHMLRVDLEDFEGRKGFAQYSSFSVGCETDGYQL 152

  Fly   236 YVLGAYKGDAGDSLRYHAGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQSKYGQ 300
            .|.|...|.||||:.||.|.||:|||:|.|:..::|||.:.||:||. .|..:|..|.:  .:|:
Zfish   153 QVSGFTDGGAGDSMTYHNGMKFSTFDKDQDNFDKSCARLYLGAFWYD-NCHHANPNGVY--LWGE 214

  Fly   301 EIGYFK-GILW 310
            :...|. |.:|
Zfish   215 DATIFAIGNVW 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1791NP_572591.1 FReD 119..331 CDD:238040 79/205 (39%)
mfap4.12XP_001339837.3 FReD 26..244 CDD:238040 79/205 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405297at33208
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.