DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf4 and AT4G19770

DIOPT Version :9

Sequence 1:NP_001285068.1 Gene:Idgf4 / 31926 FlyBaseID:FBgn0026415 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_193712.2 Gene:AT4G19770 / 827721 AraportID:AT4G19770 Length:261 Species:Arabidopsis thaliana


Alignment Length:312 Identity:85/312 - (27%)
Similarity:115/312 - (36%) Gaps:82/312 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LLESSNARIPFINSAHSLVKTYGFDGLDLGWQFPKNKPKKVHGSIGKFWKGFKKIFSGDHVVDEK 189
            :..||..|..||.|..|:.::||||||||.|::|:|                             
plant     1 MASSSYGRKSFILSTISIARSYGFDGLDLDWEYPRN----------------------------- 36

  Fly   190 AEEHKEAFTALVRELKNAFRPDGYILGLSVL---------PNVNSSLFFDVPAIINNLDYVNLHT 245
            |.|..: |..|::|.:.|.:.:.|...|.||         .|.| .:.:.|..|...||:||:..
plant    37 AAEMSD-FAELLKEWRYAVQGEAYSSELPVLILTATVYYSSNYN-GVVYPVKFISELLDWVNIKA 99

  Fly   246 YDFQTPERNNEVADFPAPIYELNERNPEFNVNYQVKYWTGNRAPAAKINVGIATYGRAWKLT--K 308
            |||..| ...||...||.:| |....|..:..  ||.|.....||.|..:|...||.||.|.  |
plant   100 YDFYGP-GCTEVTGPPAALY-LQSDGPSGDSG--VKDWIDAGLPAEKAVLGFPYYGWAWTLADPK 160

  Fly   309 DSG----LTGLPPVAEADGVAPAGTQTQIPGLLSWPEVCAKLPNPANQHLKGADGPLRKVGDPTK 369
            :.|    .||  |....||      :.....|.:|.                .|.....|.|...
plant   161 NHGYYVDTTG--PAISDDG------EISYSQLKTWI----------------VDNKATTVHDNIV 201

  Fly   370 RFGSYAYRSADDSGENGVWVGYEDPDTAAIKAEYVKREGLGGIAVVDLSFDD 421
             .|.|.|...       .|:||:..::...|..|.|::||.|.....:..||
plant   202 -IGDYCYAGT-------TWIGYDSEESIVTKVIYAKQKGLLGYFSWQVGGDD 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf4NP_001285068.1 GH18_IDGF 26..442 CDD:119352 85/312 (27%)
Glyco_18 27..420 CDD:214753 83/309 (27%)
AT4G19770NP_193712.2 GH18_chitinase-like <1..250 CDD:299167 85/312 (27%)
Glyco_18 <1..244 CDD:214753 83/309 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.