DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf4 and AT4G19740

DIOPT Version :9

Sequence 1:NP_001285068.1 Gene:Idgf4 / 31926 FlyBaseID:FBgn0026415 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_193709.3 Gene:AT4G19740 / 827718 AraportID:AT4G19740 Length:211 Species:Arabidopsis thaliana


Alignment Length:197 Identity:47/197 - (23%)
Similarity:80/197 - (40%) Gaps:45/197 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LLESSNARIPFINSAHSLVKTYGFDGLDLGWQFPKNKPKKVHGSIGKFWKGFKKIFSGDHVVDEK 189
            :..:..:|..||:|:.|:.::.||.||||.|::|.|                             
plant     1 MASNRTSRESFISSSISIARSLGFYGLDLAWEYPNN----------------------------- 36

  Fly   190 AEEHKEAFTALVRELKNAFRPDGYILGLSVL--------PNVNSSLFFDVPAIINNLDYVNLHTY 246
             :.....|..|::|.::|...:....|:..|        .:..:|:.:.|.||..:||:|||..|
plant    37 -DVEMNNFGKLLQEWRSAVEVESQRTGIRPLLLTAAVYYTSDYNSVSYPVQAINRSLDWVNLIAY 100

  Fly   247 DFQTPERNNEVADFPAPIYELNERNPEFNVNYQVKYWTGNRAPAAKINVGIATYGRAWKL--TKD 309
            :|.  ....|:.. ||.:|:.:.:.|..:..  :|:|.....|..|...|....|.:|.|  .||
plant   101 EFY--GLTTEIGP-PAGLYDPSIKGPCGDTG--LKHWLKAGLPEKKAVFGFPYVGWSWTLDDDKD 160

  Fly   310 SG 311
            .|
plant   161 HG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf4NP_001285068.1 GH18_IDGF 26..442 CDD:119352 47/197 (24%)
Glyco_18 27..420 CDD:214753 47/197 (24%)
AT4G19740NP_193709.3 GH18_chitinase-like <23..211 CDD:415847 42/175 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.