DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf4 and AT4G19730

DIOPT Version :9

Sequence 1:NP_001285068.1 Gene:Idgf4 / 31926 FlyBaseID:FBgn0026415 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_193708.1 Gene:AT4G19730 / 827717 AraportID:AT4G19730 Length:332 Species:Arabidopsis thaliana


Alignment Length:354 Identity:86/354 - (24%)
Similarity:151/354 - (42%) Gaps:71/354 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 THLVYGYAGINPSSNKL-VSNNEKLDLDLGSSLFRQVT-GLKRKYPALKVLLSVGGDKDTVDPEN 119
            |||...:|.::.:|:|: ||...:.       :|...| .:|.:.|.:|.|||:||.    :..|
plant    41 THLFCAFADLDANSHKVFVSQAHEF-------IFSTFTETVKIRNPQVKTLLSIGGK----NANN 94

  Fly   120 NKYLTLLESSNARIPFINSAHSLVKTYGFDGLDLGWQFPKNKPKKVHGSIGKFWKGFKKIFSGDH 184
            :.:.::..:..:|..||:|...:.::.||.||||.|::|.:                      ||
plant    95 SAFASMASNHQSRKTFIDSWIFIARSNGFHGLDLAWEYPYS----------------------DH 137

  Fly   185 VVDEKAEEHKEAFTALVRELKNAFRPDGYILGLSVLPNVNSSLFFDVPAIINNLDYVNLHTYDFQ 249
            .:.:......|...|:..|.:.:.:|...:.......:|..:..:.|..:..:||:||:..|||.
plant   138 EMTDFGNLVGELRAAVEAESRRSSKPTLLLTAAVYYSSVYKTFTYPVQVMRESLDWVNIIAYDFY 202

  Fly   250 TPERNNEVADFPAPIYEL----NERNPEFNVNYQVKYWTGNRAPAAKINVGIATYGRAWKL--TK 308
            .|..:::   |..|...|    |...|..:..  :|.|..:..|..|..:|.:..|.||.|  .|
plant   203 GPVSSSK---FTVPTAGLHVSSNNEGPSGDSG--LKQWIKDGLPEKKAVLGFSYVGWAWTLQNDK 262

  Fly   309 DSGLTGLPPVAEADGVAPAGTQTQIPGLLSWPEVCAKLPNPANQHLKGADGPLRKVGDPTKRFGS 373
            |:|..     |.|.|||.:.......|.:::.::        |:.::  |....||.|| |..|.
plant   263 DTGYN-----AAAAGVAKSEDDVSEDGSINYAQI--------NKFIR--DEEAAKVYDP-KVVGH 311

  Fly   374 YAYRSADDSGENGVWVGYEDPDTAAIKAE 402
            |.:...       :|:|||  ||.:::|:
plant   312 YCFAKK-------IWIGYE--DTQSVEAK 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf4NP_001285068.1 GH18_IDGF 26..442 CDD:119352 86/354 (24%)
Glyco_18 27..420 CDD:214753 86/354 (24%)
AT4G19730NP_193708.1 GH18_chitinase-like 11..332 CDD:415847 86/354 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.