DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf4 and Cht8

DIOPT Version :9

Sequence 1:NP_001285068.1 Gene:Idgf4 / 31926 FlyBaseID:FBgn0026415 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_611542.2 Gene:Cht8 / 37390 FlyBaseID:FBgn0034580 Length:476 Species:Drosophila melanogaster


Alignment Length:458 Identity:134/458 - (29%)
Similarity:212/458 - (46%) Gaps:85/458 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LFSLLVGSLAIGQISAA---GSHHLLCYYDGNSFVREGLSKLILTDLEPALQYCTHLVYGYAGIN 67
            |..||:|.:.:...|:|   .|.:::||....|..|.||.|..:.|::|.|  ||||:|.:.||.
  Fly     7 LVKLLLGVILMAASSSAQGNSSKNVVCYQGTWSVYRPGLGKFGMEDIDPFL--CTHLIYAFLGIE 69

  Fly    68 PSSN-KLVSNNEKLDLDLGSSLFRQVTGLKRKYPALKVLLSVGGDKDTVDPENNKYLTLL-ESSN 130
            .:.. :::.....|:.:.|....:....||.|.|.||.|::|||..     |.:|..:|: ...:
  Fly    70 ETGQLRVIDAYLDLEENSGRGNIKSFNALKLKNPVLKTLVAVGGWN-----EGSKRFSLVARDPS 129

  Fly   131 ARIPFINSAHSLVKTYGFDGLDLGWQFPKNKPKKVHGSIGKFWKGFKKIFSGDHVVDEKAEEHKE 195
            .|..|::.....::.:|||||||.|::|..:                      |.:|   .|.:.
  Fly   130 KREKFVDDVVRFLQRHGFDGLDLDWEYPGQR----------------------HSLD---NEDRS 169

  Fly   196 AFTALVRELKNAFRPDGYILGLSV-LPNVNSSLFFDVPAIINNLDYVNLHTYDFQTPERNNEVAD 259
            .:...::|||....|.|:||..:| ....::.:.:|:||::..||.:|:..||...|.  ::|..
  Fly   170 NYITFLKELKEGLEPFGFILSAAVGSAQFSAEISYDIPAMVPYLDLINVMAYDLHGPW--DQVVG 232

  Fly   260 FPAPIY-------ELNERNPEFNVNYQVKYWTGNRAPAAKINVGIATYGRAWKL-TKDSGLTGLP 316
            ..||:|       :.:.|..:.||:..||||....|||.|:.:|:..|||::.| |.:....|.|
  Fly   233 INAPLYAAEKDASDSSGRQQQLNVDAVVKYWLKAGAPAEKLILGVPFYGRSFTLATAEGNQPGAP 297

  Fly   317 PVAEADGVAPAGTQTQIPGLLSWPEVCAKLPN-------PANQHLKGADGPLRKVGDPTKRFGSY 374
            .:    |...||..::.||:|.:.|:|..:..       .|.|.:                  .|
  Fly   298 HI----GKGIAGNYSREPGVLGYNELCEMMEREEWTQKWEATQQV------------------PY 340

  Fly   375 AYRSADDSGENGVWVGYEDPDTAAIKAEYVKREGLGGIAVVDLSFDDFRGGCTGHDKFPILRQVK 439
            |||...       |||||||.:.|:||:||....||||.:..|..|||||.| |...:|:|.::.
  Fly   341 AYRQRQ-------WVGYEDPRSLALKAQYVMDNHLGGIMIWSLESDDFRGTC-GQQPYPLLHEIN 397

  Fly   440 SKL 442
            ..|
  Fly   398 RVL 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf4NP_001285068.1 GH18_IDGF 26..442 CDD:119352 126/433 (29%)
Glyco_18 27..420 CDD:214753 117/410 (29%)
Cht8NP_611542.2 GH18_chitolectin_chitotriosidase 31..400 CDD:119351 126/432 (29%)
Glyco_18 31..379 CDD:214753 117/410 (29%)
CBM_14 424..476 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463810
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I1336
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
65.890

Return to query results.
Submit another query.