DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf4 and CG8460

DIOPT Version :9

Sequence 1:NP_001285068.1 Gene:Idgf4 / 31926 FlyBaseID:FBgn0026415 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_609190.2 Gene:CG8460 / 34115 FlyBaseID:FBgn0031996 Length:402 Species:Drosophila melanogaster


Alignment Length:310 Identity:67/310 - (21%)
Similarity:104/310 - (33%) Gaps:100/310 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GYAGINPSSNKLVSNNEKLDLDLGSSLFRQVTGLKRKYPALKVLLSVGGDKDTVDPENNKYLTLL 126
            |.....|.:..:|||:.        ..|:: |||:|         ..|.....|.|.|:....:.
  Fly    54 GLVSPEPLAKDIVSNHR--------GYFKE-TGLRR---------FNGTTLGYVTPWNSHGYDVA 100

  Fly   127 ESSNARIPFINSAH-SLVK------TYGFDGLDLGWQFP-KNKPKKVHGSIGKFWKGFKKIFSGD 183
            :....:...|:... .:||      ..|...:|.||... :.|.|:||..  :..|.|.: |..|
  Fly   101 KIFAKKFDIISPVWLQIVKQGDRYAVAGTHDIDAGWLTDVRRKGKQVHNQ--RTVKVFPR-FIFD 162

  Fly   184 HVVD-------EKAEEHKEAFTALVRELK-NAFRPDGYILG------------------------ 216
            |..|       ..|:|..:....|::..| |.|  ||.:|.                        
  Fly   163 HFTDRDIKLLLSDAQERTKVNDVLIKCCKDNGF--DGLVLEVWSQLAGRIDDKILYTLVLQMAKE 225

  Fly   217 --------LSVLP---NVNSSLFFD--VPAIINNLDYVNLHTYDF---QTPERNNEVADFPAPIY 265
                    :.|:|   .....||.:  :..:..::...:|.||||   |.|..|       ||:|
  Fly   226 LQKQQLRLILVIPPFRKETGHLFGEKHMDKLFKHIYAFSLMTYDFSSVQRPGAN-------APLY 283

  Fly   266 ELNER----NPEFNVNYQVKYWTGNRAPAAKINVGIATYGRAWKLTKDSG 311
            .:.:.    .||...:...|        .|||.:|:..||..:  |.|.|
  Fly   284 FVRKAVETIAPEGCADMTAK--------RAKILLGLNMYGNDY--TPDGG 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf4NP_001285068.1 GH18_IDGF 26..442 CDD:119352 67/310 (22%)
Glyco_18 27..420 CDD:214753 67/310 (22%)
CG8460NP_609190.2 GH18_SI-CLP 81..402 CDD:119355 57/265 (22%)
Glyco_18 86..393 CDD:214753 56/260 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463846
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.