DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf4 and Cda4

DIOPT Version :9

Sequence 1:NP_001285068.1 Gene:Idgf4 / 31926 FlyBaseID:FBgn0026415 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_728468.1 Gene:Cda4 / 33144 FlyBaseID:FBgn0052499 Length:486 Species:Drosophila melanogaster


Alignment Length:157 Identity:25/157 - (15%)
Similarity:50/157 - (31%) Gaps:56/157 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 VNLHTYD-FQTPERNNEVADFPAPIYELNERNP-------------EFNVNYQVKYWTGNRAPAA 291
            |||:.|. :|             .|::...:||             |::...|:::         
  Fly   141 VNLNNYQHYQ-------------KIFDGKRKNPNGCLIRGTFFMSHEYSNYQQIQH--------- 183

  Fly   292 KINVGIATYGRAWKLTKDSGLTGLPPVAEADGVAPAGTQTQIPGLLSWPEVCAKLPNPANQHLKG 356
                 :..||..         .|...:::..|:...|.:..:..::...|:.....|.:...:.|
  Fly   184 -----LGYYGHE---------IGTESISQQQGLQDKGYEEWVGEMIGMREILRHFANVSVNDVVG 234

  Fly   357 ADGPLRKVGDPTKRFGSYAYRSADDSG 383
            ...|..|.|..|:      |:..:|.|
  Fly   235 MRAPFLKPGRNTQ------YKVLEDFG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf4NP_001285068.1 GH18_IDGF 26..442 CDD:119352 25/157 (16%)
Glyco_18 27..420 CDD:214753 25/157 (16%)
Cda4NP_728468.1 CBM_14 33..80 CDD:279884
CE4_CDA_like_1 130..396 CDD:200596 25/157 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463789
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.