DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf4 and Chil5

DIOPT Version :9

Sequence 1:NP_001285068.1 Gene:Idgf4 / 31926 FlyBaseID:FBgn0026415 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001074285.1 Gene:Chil5 / 229687 MGIID:2676649 Length:431 Species:Mus musculus


Alignment Length:461 Identity:127/461 - (27%)
Similarity:203/461 - (44%) Gaps:105/461 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLVGSLAI---GQISAAGSHHLLCYYDGNSFVREGLSKLILTDLEPALQYCTHLVYGYAGINPSS 70
            :||..||:   .|:.:|  :.|:|||:..:..|..|......|::|.|  ||||:|.:||:..:.
Mouse     5 ILVTGLALLLNPQLGSA--YQLMCYYNNVAQNRPKLGSFNPADIDPCL--CTHLIYAFAGMQNNK 65

  Fly    71 NKLVSNNEKLDLDLGSSLFRQVTGLKRKYPALKVLLSVGGDKDTVDPENNKYLTLLESSNARIPF 135
            ..:.|.|:..|       ::.:..||.:...||.||::||......|    :..::.:.:.:..|
Mouse    66 VTMRSMNDLTD-------YQALNTLKSRNVQLKTLLAIGGRDFGPAP----FSAMVSTPHNQQTF 119

  Fly   136 INSAHSLVKTYGFDGLDLGWQFPKNKPKKVHGSIGKFWKGFKKIFSGDHVVDEKAEEHKEAFTAL 200
            ||||...::.||||||:|.||||        ||.|                  .....|..||.|
Mouse   120 INSAIKFLRQYGFDGLNLDWQFP--------GSRG------------------SPSRDKHLFTVL 158

  Fly   201 VRELKNAFRPDGYILGLSVLPNVNSSLF---------------FDVPAIINNLDYVNLHTY---- 246
            |::::.||.       |..:.|.:..|.               :::|.:.:.|||:.:.||    
Mouse   159 VQKIREAFE-------LEAIENKSPRLMVTATVAGVISTIQSGYEIPQLSHFLDYIQVMTYNLHG 216

  Fly   247 --DFQTPERNNEVADFPAPIYE-LNER--NPEFNVNYQVKYWTGNRAPAAKINVGIATYGRAWKL 306
              |..|.|.        :|:|: ||:.  |...||:|.:.||..|.|...|:.||...||:.:.|
Mouse   217 SQDGYTGEN--------SPLYKSLNDTGINTLLNVDYIMTYWNENGAAPEKLIVGFPAYGQTFTL 273

  Fly   307 TKDSGLTGLPPVAEADGVAPAGTQTQIPGLLSWPEVCAKLPNPANQHLKGADGPLRKVGDPTKRF 371
            :..|......|.|.|..:.|   .|:..|..::.|:|:.|.:.|.:....|    ::|       
Mouse   274 SDPSNNGISAPTASAGTLGP---YTEESGTWAYYEICSFLNDGATEAWDSA----QEV------- 324

  Fly   372 GSYAYRSADDSGENGVWVGYEDPDTAAIKAEYVKREGLGGIAVVDLSFDDFRGGCTGHDKFPILR 436
             .|||       :...||||::..:..||||::|:..|||..:..|..|||.|......:||:..
Mouse   325 -PYAY-------QGNKWVGYDNVKSFRIKAEWLKQNNLGGAMLWTLDMDDFTGSFCNQGQFPLTS 381

  Fly   437 QVKSKL 442
            .:|:.|
Mouse   382 TLKNAL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf4NP_001285068.1 GH18_IDGF 26..442 CDD:119352 120/439 (27%)
Glyco_18 27..420 CDD:214753 113/416 (27%)
Chil5NP_001074285.1 GH18_chitolectin_chitotriosidase 24..387 CDD:119351 120/438 (27%)
Glyco_18 26..365 CDD:214753 112/414 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846847
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.