DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf4 and chil-9

DIOPT Version :10

Sequence 1:NP_511101.2 Gene:Idgf4 / 31926 FlyBaseID:FBgn0026415 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001366720.1 Gene:chil-9 / 191470 WormBaseID:WBGene00014162 Length:460 Species:Caenorhabditis elegans


Alignment Length:37 Identity:9/37 - (24%)
Similarity:17/37 - (45%) Gaps:0/37 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RGGTPRGTTTVSPILCLMNWNDEQCRQQLKSYIPKFA 44
            |..:|....:::.:....:.|....|:.|:|.|.|.|
 Worm    22 RTDSPDLVASLNALSSFYDENSAHARRNLRSTIEKRA 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf4NP_511101.2 GH18_IDGF 26..442 CDD:119352 7/19 (37%)
chil-9NP_001366720.1 Glyco_18 113..431 CDD:214753
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.