DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf4 and chil-27

DIOPT Version :9

Sequence 1:NP_001285068.1 Gene:Idgf4 / 31926 FlyBaseID:FBgn0026415 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_496035.1 Gene:chil-27 / 188616 WormBaseID:WBGene00011848 Length:407 Species:Caenorhabditis elegans


Alignment Length:198 Identity:52/198 - (26%)
Similarity:78/198 - (39%) Gaps:49/198 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LDLDLGSSLFRQVTGLKRKYPA----LKVLLSVGGDKDTVDPENNKYLTL-LESSNARIPFINSA 139
            :::|..|..|.:   ||.|...    .|.|||:||      ..|.::|.| :.....:..|..|.
 Worm   117 VEVDHSSRTFSK---LKEKSKIESSHFKKLLSIGG------RSNTQFLPLVIADPRRKRRFFKSI 172

  Fly   140 HSLVKTYGFDGLDLGWQFPKNKPKKVHGSIGKFWKGFKKIFSGDHVVDEKAEEHKEAFTALVREL 204
            .|:::.|..||:||.|::.||...|   ...:|....|          :|.:|.|          
 Worm   173 ISILEEYQLDGVDLLWKWAKNSNTK---KCSRFLCELK----------QKLKERK---------- 214

  Fly   205 KNAFRPDGYILGLSVLPNVNSSLFFDVPAIINNLDYVNLHTYDFQT-PERNNEVADFPAPIYELN 268
            ||      |:|.:.:||:..||.....||   |...:|:...|..| |:  .||.:......|..
 Worm   215 KN------YVLSVQILPDEPSSWELFNPA---NGSPLNIQVEDCNTGPD--TEVVEPSDSELEST 268

  Fly   269 ERN 271
            |.|
 Worm   269 ENN 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf4NP_001285068.1 GH18_IDGF 26..442 CDD:119352 52/198 (26%)
Glyco_18 27..420 CDD:214753 52/198 (26%)
chil-27NP_496035.1 Glyco_hydro_18 89..>228 CDD:279094 38/148 (26%)
GH18_chitinase-like 97..>235 CDD:299167 40/155 (26%)
Glyco_hydro_18 261..>402 CDD:279094 3/11 (27%)
GH18_chitinase-like 268..>407 CDD:299167 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.