Sequence 1: | NP_001285068.1 | Gene: | Idgf4 / 31926 | FlyBaseID: | FBgn0026415 | Length: | 442 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_496035.1 | Gene: | chil-27 / 188616 | WormBaseID: | WBGene00011848 | Length: | 407 | Species: | Caenorhabditis elegans |
Alignment Length: | 198 | Identity: | 52/198 - (26%) |
---|---|---|---|
Similarity: | 78/198 - (39%) | Gaps: | 49/198 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 80 LDLDLGSSLFRQVTGLKRKYPA----LKVLLSVGGDKDTVDPENNKYLTL-LESSNARIPFINSA 139
Fly 140 HSLVKTYGFDGLDLGWQFPKNKPKKVHGSIGKFWKGFKKIFSGDHVVDEKAEEHKEAFTALVREL 204
Fly 205 KNAFRPDGYILGLSVLPNVNSSLFFDVPAIINNLDYVNLHTYDFQT-PERNNEVADFPAPIYELN 268
Fly 269 ERN 271 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Idgf4 | NP_001285068.1 | GH18_IDGF | 26..442 | CDD:119352 | 52/198 (26%) |
Glyco_18 | 27..420 | CDD:214753 | 52/198 (26%) | ||
chil-27 | NP_496035.1 | Glyco_hydro_18 | 89..>228 | CDD:279094 | 38/148 (26%) |
GH18_chitinase-like | 97..>235 | CDD:299167 | 40/155 (26%) | ||
Glyco_hydro_18 | 261..>402 | CDD:279094 | 3/11 (27%) | ||
GH18_chitinase-like | 268..>407 | CDD:299167 | 2/4 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG3325 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |