DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf4 and chil-17

DIOPT Version :9

Sequence 1:NP_001285068.1 Gene:Idgf4 / 31926 FlyBaseID:FBgn0026415 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_496019.1 Gene:chil-17 / 187733 WormBaseID:WBGene00011159 Length:435 Species:Caenorhabditis elegans


Alignment Length:432 Identity:87/432 - (20%)
Similarity:157/432 - (36%) Gaps:149/432 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YDGNSFVREGLSKLILTDLEPALQYCTHLVYGYAGINPSSNKLVSNNEKLDLDLGSSLFRQVT-- 93
            ||.....:..|:||            ||.|:.:..|            |.|   |:..|:.:.  
 Worm    85 YDSTDISKNQLAKL------------THAVFAFVDI------------KYD---GTLQFKNLITE 122

  Fly    94 ----GLKRK----YPALKVLLSVGGDKDTVDPENNKYLTLLESSNARIPFINSAHSLVKTYGFDG 150
                .||.|    :..||::.|:|||:::.|     :.:.|.::..:...|.|..:.:.::..||
 Worm   123 QKFFSLKSKARSLHSNLKLMFSIGGDENSFD-----FSSALANTQMKSTLITSIIAFIHSHMIDG 182

  Fly   151 LDLGWQFPKNKPKKVHGSIGKFWKGFKKIFSGDHVVDEKAEEHKEAFTALVRELKNAF-RPDGYI 214
            :||.|::|.::                               .|..:..|:||::... ..|..|
 Worm   183 VDLHWKWPTSR-------------------------------DKSNYATLIREIREKVDELDAKI 216

  Fly   215 LGLSVLPNVNSSLF---FDVPAIINNLDYVNLHTYDFQTPERNNEVADFPAPIYELNER---NPE 273
            :....:|.|..|.:   ||:.||..::|::|:|:.|:..| ..|:......|...:|..   ...
 Worm   217 IISITIPPVGVSDWESGFDLDAIQKHVDFINVHSMDYAKP-LPNQWGTPTGPSASMNFNIGLRQH 280

  Fly   274 FNVNYQVKYWTGNRAPAAKINVGIATYGRAWKLT----------------KDSGLTGLPPVA--- 319
            :||::.:|::|......:.||:.|..|.|.||..                ||:.:.|...::   
 Worm   281 YNVDWTMKHYTCELKKPSMINLVIPFYVRMWKNVQKAIDNRTEVFRNVELKDNEVEGRSQLSRYT 345

  Fly   320 ---EADGVAPAG--TQTQIPGLLSWPEVCAKLPNPANQHLKGADGPLRKVGDPTKRFGSYAYRSA 379
               |...::|..  ..||.|.:|.               ||            |:.|.:      
 Worm   346 VEHEDMELSPESWDNATQTPYVLD---------------LK------------TRTFFT------ 377

  Fly   380 DDSGENGVWVGYEDPDTAAIKAEYVKREGLGGIAVVDLSFDD 421
                       ||:..:..:|.:||.:..|||:.:..:..||
 Worm   378 -----------YENEKSIKVKLDYVNKMDLGGVWIWSVDMDD 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf4NP_001285068.1 GH18_IDGF 26..442 CDD:119352 87/432 (20%)
Glyco_18 27..420 CDD:214753 85/429 (20%)
chil-17NP_496019.1 Glyco_18 77..407 CDD:214753 85/429 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164391
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X91
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.700

Return to query results.
Submit another query.