DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf4 and K08F9.3

DIOPT Version :9

Sequence 1:NP_001285068.1 Gene:Idgf4 / 31926 FlyBaseID:FBgn0026415 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001263897.1 Gene:K08F9.3 / 187168 WormBaseID:WBGene00010686 Length:287 Species:Caenorhabditis elegans


Alignment Length:264 Identity:51/264 - (19%)
Similarity:91/264 - (34%) Gaps:98/264 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LYALFSLLVGSLAIGQISAAG----------SHHLLCYYDGNSFVREGLSKLILTDLEPALQYCT 57
            |..||.|:.|..::  :|.:|          ...|:.||:|    .||.:     .||......|
 Worm    92 LLFLFVLIFGIYSL--VSHSGHVQSTTPDQCDKQLIGYYNG----IEGRN-----ILENQFHNLT 145

  Fly    58 HLVYGYAGINPSSNKLVSNNEKLDLD----LGSSLFRQVTGLKRKYPALKVLLSVGGDKDTVDPE 118
            |.|:....:|.:.:...|:.|:..|:    ||.|           ....|:::::|.:|.:..  
 Worm   146 HAVFTSEFVNENGSFENSHKEQEFLECRKKLGES-----------NSTAKIMIAMGFNKGSCK-- 197

  Fly   119 NNKYLTLLESSNARIPFINSAHSLVKTYGFDGLDLGWQFPKNKPKKVHGSIGKFWKGFKKIFSGD 183
                             |:...|.::.|..||::|.|                            
 Worm   198 -----------------IDCITSFIEKYQVDGVELHW---------------------------- 217

  Fly   184 HVVDEKAEEHKEAFTA---LVRELKNAFR--PDGYILGLSVLPNVNSSLFFDVPAIINNLDYVNL 243
                    .|.|.|.:   ..|.|||..:  .:..:||:|.  :.|.|...::..::...|:||:
 Worm   218 --------NHNEHFLSQLETTRNLKNRLKKISNSKLLGVSA--SSNWSRVTELDQVLEVADFVNI 272

  Fly   244 HTYD 247
            ..:|
 Worm   273 ELHD 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf4NP_001285068.1 GH18_IDGF 26..442 CDD:119352 44/231 (19%)
Glyco_18 27..420 CDD:214753 44/230 (19%)
K08F9.3NP_001263897.1 Glyco_hydro_18 122..>272 CDD:279094 42/226 (19%)
GH18_chitinase-like 124..276 CDD:299167 43/228 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.