DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf4 and chil-6

DIOPT Version :9

Sequence 1:NP_001285068.1 Gene:Idgf4 / 31926 FlyBaseID:FBgn0026415 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_496126.1 Gene:chil-6 / 182436 WormBaseID:WBGene00007471 Length:460 Species:Caenorhabditis elegans


Alignment Length:407 Identity:84/407 - (20%)
Similarity:152/407 - (37%) Gaps:113/407 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LQYCTHLVYGYAGINPSSNKLVSNNEKLDLDLGSSLFRQVTGLKRKYPA-----------LKVLL 106
            ||..||::|.:|         :..|       ||..||..:. :||:.|           |||::
 Worm   131 LQMLTHIIYLFA---------IPKN-------GSLTFRDESS-RRKFVAMKNEARKESSTLKVMI 178

  Fly   107 SVGGDKDTVDPENNKYLTLLESSNARIPFINSAHSLVKTYGFDGLDLGWQFPKNKPKKVHGSIGK 171
            |:||..     .:.::..|:....:|..|.||..|.|:.|..||:|:.|.:||            
 Worm   179 SIGGQY-----SSGEFSGLVSKETSRNLFTNSIVSFVQNYDIDGVDIFWTWPK------------ 226

  Fly   172 FWKGFKKIFSGDHVVDEKAEEHKEAFTALVRELKNAFRPDGYILGLSVLPNVNSSLFFDVPAIIN 236
                    :|.::.......|.:.|||.|.::|.   |.:.:::.|.:..|||.  ..::....|
 Worm   227 --------YSDENNYLMFIRELRYAFTELQKKLN---RKETFVISLVISRNVNH--LSNLVEFSN 278

  Fly   237 NLDYVNLHTYDFQTPERNNEVADFPAPIYELNERNPEFNVNYQVKYWTGNRAPAAKINVGIATYG 301
            .:|::|::.::    ...|::.. .:|:|....|    .|:..:||:.......:|.|:.::.:.
 Worm   279 FVDFLNIYLFN----SFLNQIGP-DSPLYGGGSR----IVDENMKYYICKSGQPSKFNIIVSFHA 334

  Fly   302 RAWKLTKDSGLTGLPPVAEADGVAPAGTQTQIPGLL--------SWPEVCAKLPNPANQHLKGAD 358
            ..|...:      ||...::|.:.......::|..|        :|.....|..|..........
 Worm   335 TYWNGAE------LPLRDDSDDIWKDNNSGRLPIALPRRQLRQYNWNLTDIKFHNLTKTSYIWIP 393

  Fly   359 GPLRKVGDPTKRFGSYAYRSADDSGENGVWVGYEDPDTAAIKAEYVKREGLGGIAVVDLSFDDFR 423
            ||      ||:                  ::..|:..:...|..||....:|||.:..:..||  
 Worm   394 GP------PTR------------------FMTLEEERSLREKNRYVADHNIGGITMWTIDQDD-- 432

  Fly   424 GGCTGHDKFPILRQVKS 440
                  |...:|:.|.|
 Worm   433 ------DDHTLLKVVSS 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf4NP_001285068.1 GH18_IDGF 26..442 CDD:119352 84/407 (21%)
Glyco_18 27..420 CDD:214753 78/385 (20%)
chil-6NP_496126.1 Glyco_18 113..431 CDD:214753 78/385 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164369
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.