DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf4 and chil-5

DIOPT Version :9

Sequence 1:NP_001285068.1 Gene:Idgf4 / 31926 FlyBaseID:FBgn0026415 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_496127.1 Gene:chil-5 / 182435 WormBaseID:WBGene00007470 Length:459 Species:Caenorhabditis elegans


Alignment Length:419 Identity:94/419 - (22%)
Similarity:156/419 - (37%) Gaps:110/419 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FVREGLSKLILTDLEPALQYCTHLVYGYAGINPSSNKLVSNNEKLDLDLGSSLFRQVTGLKRK-- 98
            |...|||:       ..|...||::|.:|  .|:       |..:.|| |....|:...:|.|  
 Worm   120 FENAGLSR-------KQLHMLTHIIYLFA--RPT-------NGVITLD-GEQTRRKFEEMKSKAR 167

  Fly    99 --YPALKVLLSVGGDKDTVDPENNKYLTLLESSNARIPFINSAHSLVKTYGFDGLDLGWQFPKNK 161
              ...|||::||||     .....:|..|:.:..:|..|:.|..|..|....||:::.|..||.:
 Worm   168 EASSTLKVMISVGG-----HDYYKEYSRLVSNETSRNVFVKSIVSFFKKNDIDGIEIFWTRPKYE 227

  Fly   162 PKKVHGSIGKFWKGFKKIFSGDHVVDEKAEEHKEAFTALVRELKNAFRPDGYILGLSVLPNVNSS 226
            ..|.:.|.                    .:|.:.|||.|.:...   |.:.||:.|.|....:.|
 Worm   228 DIKSYSSF--------------------IQELRSAFTELQKRWN---RKNEYIISLIVPKEKHWS 269

  Fly   227 LFFDVPAIINNLDYVNLHTYDFQTPERNNEVADFPAPIYELNERNPEFNVNYQVKYWTGNRAPAA 291
              ||:......:|:.|:::..|    |..:|.. .:|:|....|    |::..:||:.......:
 Worm   270 --FDLKDFSKFVDFFNIYSTQF----REKQVGP-DSPLYGGEGR----NIDETMKYYICKTGQPS 323

  Fly   292 KINVGIATYGRAWKLTKDSGLTGLPPVAEADGVAPAGTQTQIPGLLSWPEVCAKLPNPANQHLKG 356
            |.|:.::.:|..|:..:      ||....:|.:.......:.|..:.|            :||:.
 Worm   324 KFNIMVSFHGTFWEGAE------LPLRDYSDDIWKEKNVARGPFAVRW------------RHLRQ 370

  Fly   357 ADGPLR--KVGDPTKRFGSYAYRSADDSGENGVWV--------GYEDPDTAAIKAEYVKREGLGG 411
            .:..|.  |..:.||.  ||            :|:        ..||..:...|..||....:||
 Worm   371 RNWNLTDIKFHNLTKT--SY------------IWIPGPPTWFLTLEDEKSLREKNRYVADHNIGG 421

  Fly   412 IAVVDLSFDDFRGGCTGHDKFPILRQVKS 440
            |.:..:..||        |...:|:.|.|
 Worm   422 ITMWTIDQDD--------DDHTLLKVVSS 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf4NP_001285068.1 GH18_IDGF 26..442 CDD:119352 94/419 (22%)
Glyco_18 27..420 CDD:214753 88/397 (22%)
chil-5NP_496127.1 Glyco_18 112..430 CDD:214753 88/397 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164372
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.