DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf4 and chil-13

DIOPT Version :10

Sequence 1:NP_511101.2 Gene:Idgf4 / 31926 FlyBaseID:FBgn0026415 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_496018.2 Gene:chil-13 / 174500 WormBaseID:WBGene00010945 Length:439 Species:Caenorhabditis elegans


Alignment Length:68 Identity:15/68 - (22%)
Similarity:22/68 - (32%) Gaps:13/68 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PKFASNFDAPRHVPQP----------PSSPSYDYEGDEDEEK---KEEKDHGIADRSMNDVSGET 92
            |.:.|.|....::|.|          ...|....:.|..||.   ..::.|||..|..:....|.
 Worm    23 PYYRSVFAQQAYLPHPYPGVQLQLMGMQQPGVPLQCDAVEEPVFVNAKQYHGILRRRQSRAKLEA 87

  Fly    93 TGR 95
            ..|
 Worm    88 RNR 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf4NP_511101.2 GH18_IDGF 26..442 CDD:119352 15/68 (22%)
chil-13NP_496018.2 Glyco_18 81..411 CDD:214753 2/10 (20%)

Return to query results.
Submit another query.