DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf4 and btb-16

DIOPT Version :9

Sequence 1:NP_001285068.1 Gene:Idgf4 / 31926 FlyBaseID:FBgn0026415 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_494499.2 Gene:btb-16 / 173674 WormBaseID:WBGene00018195 Length:304 Species:Caenorhabditis elegans


Alignment Length:247 Identity:46/247 - (18%)
Similarity:90/247 - (36%) Gaps:84/247 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 HLVYGYAG---INPS---------SNKLVSNNE------KLDLD-LGSSLFRQVTGL-------- 95
            |::.|..|   ::.|         |.::|:||.      |.:.| .|:....::.|.        
 Worm    19 HMMSGQGGTTVLDTSTTNGLKCTWSGEIVNNNSQICFTWKFEYDEAGNEDIDKIAGAIDVKFGQN 83

  Fly    96 -KRKYPALKVLLSVGGDKDT----VDPENNKYLTLLESSNARIPFINSAHSLVKTYGFDGLDLGW 155
             .:.:..::.|:|:.....|    |:..|.:....:....|.:|:|....     :.||.:.|  
 Worm    84 QSQNFTTVRTLVSLTEPCQTLTKVVENPNRQGAVEVMYEYALVPWITPLQ-----FSFDEMFL-- 141

  Fly   156 QFPKNK--------PKKVHGSIGKFWKG-----FKKIFSGDHVVDEKAEEHKEAFTALVRELKNA 207
              |..|        .:|:|  :.|.:..     |:.:||.:...|::.|          .|||:.
 Worm   142 --PSEKNDAFLVIGERKLH--VNKAFLSYHSDYFQALFSSNFKEDKQDE----------IELKDV 192

  Fly   208 FRPDGYILGLSVLPNVNSSLF---------------FDVPAIINNLDYVNLH 244
            ...|..:|..::.|   .::|               |.|.:.|::::|..||
 Worm   193 VYEDFGLLMSTIYP---KTVFPCDRTVEKILAMADRFIVQSAIDHVEYHLLH 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf4NP_001285068.1 GH18_IDGF 26..442 CDD:119352 46/247 (19%)
Glyco_18 27..420 CDD:214753 46/247 (19%)
btb-16NP_494499.2 BTB 147..243 CDD:197585 21/110 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.