DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf4 and CTBS

DIOPT Version :9

Sequence 1:NP_001285068.1 Gene:Idgf4 / 31926 FlyBaseID:FBgn0026415 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_004379.1 Gene:CTBS / 1486 HGNCID:2496 Length:385 Species:Homo sapiens


Alignment Length:369 Identity:78/369 - (21%)
Similarity:138/369 - (37%) Gaps:116/369 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 KVLLSVGGD---KDTVDPENNKYLTLLESSNARIPFINSAHSLVKTYGFDGLDLGWQFPKNKPKK 164
            :|:|.  ||   ||.:||.            .|..:|....:|.||...||:::..:...|    
Human   101 RVVLK--GDVSLKDIIDPA------------FRASWIAQKLNLAKTQYMDGINIDIEQEVN---- 147

  Fly   165 VHGSIGKFWKGFKKIFSGDHVVDEKAEEHKEAFTALVRELKNAFRPDGYILGLSVLPNVNSSLFF 229
                          ..|.::          :|.||||:|..::|..:  |.|        |.:.|
Human   148 --------------CLSPEY----------DALTALVKETTDSFHRE--IEG--------SQVTF 178

  Fly   230 DV--------------PAIINNLDYVNLHTYDFQTPERNNEVADFPAPIYE-LNERNPEFNVNYQ 279
            ||              ..|.:..|::.:.:||.|:...:..:|...||..: |...|....::..
Human   179 DVAWSPKNIDRRCYNYTGIADACDFLFVMSYDEQSQIWSECIAAANAPYNQTLTGYNDYIKMSIN 243

  Fly   280 VKYWTGNRAPAAKINVGIATYGRAW---KLTKDSGLT--GLP----PVAEADGVAPAGTQTQIPG 335
            .|          |:.:|:..||..:   .|::|...|  .:|    |.::|.|       .|:|.
Human   244 PK----------KLVMGVPWYGYDYTCLNLSEDHVCTIAKVPFRGAPCSDAAG-------RQVPY 291

  Fly   336 LLSWPEVCAKLPNPANQHLKGADGPLRKVGDPTKRFGSYAYRSADDSGE-NGVWVGYEDPDTAAI 399
            .....::        |..:.|      .:.|..:|...|.|:  |.:|. :.||  |::|.:.::
Human   292 KTIMKQI--------NSSISG------NLWDKDQRAPYYNYK--DPAGHFHQVW--YDNPQSISL 338

  Fly   400 KAEYVKREGLGGIAVVDLSFDDFRGGCTGHDKFPILRQV-KSKL 442
            ||.|::...|.||.:.:.:..|:.|......:...:.:| |.||
Human   339 KATYIQNYRLRGIGMWNANCLDYSGDAVAKQQTEEMWEVLKPKL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf4NP_001285068.1 GH18_IDGF 26..442 CDD:119352 76/367 (21%)
Glyco_18 27..420 CDD:214753 72/344 (21%)
CTBSNP_004379.1 GH18_chitobiase 39..378 CDD:119354 74/363 (20%)
Glyco_18 <115..358 CDD:214753 66/327 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.