DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Idgf4 and T19H5.6

DIOPT Version :9

Sequence 1:NP_001285068.1 Gene:Idgf4 / 31926 FlyBaseID:FBgn0026415 Length:442 Species:Drosophila melanogaster
Sequence 2:NP_001254213.1 Gene:T19H5.6 / 13186491 WormBaseID:WBGene00044807 Length:286 Species:Caenorhabditis elegans


Alignment Length:239 Identity:57/239 - (23%)
Similarity:100/239 - (41%) Gaps:75/239 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YYDG---NSFVREGLSKLILTDLEPALQYCTHLVYGYAGINPSSNKLVSN----NEKLDLDLGSS 87
            ||.|   :....|.:|:|            ||.|:.:..:......:.||    |..|.|     
 Worm    73 YYAGTEKSQITIEEVSEL------------THAVFAFVYMATDGTLMFSNQAQRNRFLKL----- 120

  Fly    88 LFRQVTGLKRKYPALKVLLSVGGDKDTVDPENNKYLTLLESSNARIPFINSAHSLVKTYGFDGLD 152
              :::|  |.:...:|::.|:|| ||    .:..:..:..|.:.:..|||:...|::.|..||:|
 Worm   121 --KELT--KNENSTVKMMFSIGG-KD----NSQNFSPVTASPDRKKSFINAILELLEKYDLDGVD 176

  Fly   153 LGWQFPKNKPKKVHGSIGKFWKGFKKIFSGDHVVDEKAEEHKEAFTALVRELK---NAFRPDGYI 214
            |.|::||:                               :.|:.:...:||||   .|.|.| ||
 Worm   177 LFWRWPKS-------------------------------DDKDEYAVFLRELKKQLKARRKD-YI 209

  Fly   215 LGLSVLP-NVNS-SLFFDVPAIINNLDYVNLH-----TYDFQTP 251
            |.:.|.| ::|. ...||:..||.:.|:::::     |.|.::|
 Worm   210 LSVVVAPLDINRWDSKFDIKKIIKHADFISIYGLAKNTTDSESP 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Idgf4NP_001285068.1 GH18_IDGF 26..442 CDD:119352 57/239 (24%)
Glyco_18 27..420 CDD:214753 57/239 (24%)
T19H5.6NP_001254213.1 Glyco_18 69..>255 CDD:214753 57/239 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164387
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.700

Return to query results.
Submit another query.