DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and LIPG

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_005258447.1 Gene:LIPG / 9388 HGNCID:6623 Length:536 Species:Homo sapiens


Alignment Length:271 Identity:94/271 - (34%)
Similarity:131/271 - (48%) Gaps:29/271 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 KLALFLHGWNDQG-SKDWVQELLLTWTLFDSNYNVCVVDWGNLSQNDYKSASMSIFDVGLTVAGI 157
            |....:|||...| .::|:.:|:......:.:.||.||||..|:...|..|..:...||.::|.:
Human   120 KTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNTRVVGHSIARM 184

  Fly   158 IMALEELRPNHFHRSNVTLAGYSLGAHAAGYAGAVLEGQVEQIIGLDPAGPLFSLPAEVAPKYRL 222
            :..|:|  .:.|...||.|.|||||||.|||||..::|.|.:|.|||||||:|. .|::  ..||
Human   185 LDWLQE--KDDFSLGNVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMFE-GADI--HKRL 244

  Fly   223 DPGDAQFVQVLHT----SGGSLGTSLKCGHADFYPNGGRAPQTNCKMFANLRDMQN-------TN 276
            .|.||.||.||||    .|.|:|..:..||.|.|||||.. |..|    .|.|:..       |.
Human   245 SPDDADFVDVLHTYTRSFGLSIGIQMPVGHIDIYPNGGDF-QPGC----GLNDVLGSIAYGTITE 304

  Fly   277 PVSCSHSAAAIFFRQSM-DPEYPFVGYECGSYREFAAGYCDGNRKAR---FGIHSQR---RAQGS 334
            .|.|.|..|...|..|: :.:.|...::|.....|..|.|...||.|   .|.::::   :....
Human   305 VVKCEHERAVHLFVDSLVNQDKPSFAFQCTDSNRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSK 369

  Fly   335 FYFRTAPQQPY 345
            .|.:|....|:
Human   370 MYLKTRAGMPF 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 93/265 (35%)
LIPGXP_005258447.1 Pancreat_lipase_like 85..376 CDD:238363 93/265 (35%)
lipo_lipase 86..521 CDD:132274 94/271 (35%)
PLAT_LPL 383..519 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.