DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and Pnliprp1

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_114470.1 Gene:Pnliprp1 / 84028 RGDID:620792 Length:473 Species:Rattus norvegicus


Alignment Length:320 Identity:99/320 - (30%)
Similarity:147/320 - (45%) Gaps:48/320 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LQLGD--LRGFRRLDPNKKLALFLHGWNDQGSKDWVQELLLTWTLFDSNYNVCVVDWGNLSQNDY 140
            |||.|  ..|.......:|....:||:.|:|.::||.::.......:....:| |||...||..|
  Rat    70 LQLSDPLTIGASNFQVARKTRFIIHGFIDKGEENWVVDMCKNMFQVEEVNCIC-VDWKKGSQTTY 133

  Fly   141 KSASMSIFDVGLTVAGIIMALEELRPNHFHRSNVTLAGYSLGAHAAGYAGAVLEGQVEQIIGLDP 205
            ..|:.::..||..||.:|..|  ::...:..|.|.|.|:|||||.||.||:...| :.:|.||||
  Rat   134 TQAANNVRVVGAQVAQMIDIL--VKNYSYSPSKVHLIGHSLGAHVAGEAGSRTPG-LGRITGLDP 195

  Fly   206 AGPLF-SLPAEVAPKYRLDPGDAQFVQVLHTSGGSL------GTSLKCGHADFYPNGGRAPQTNC 263
            ....| ..|.||    ||||.||.||.|:||....|      ||:...||.||:||||:: ...|
  Rat   196 VEANFEGTPEEV----RLDPSDADFVDVIHTDAAPLIPFLGFGTNQMSGHLDFFPNGGQS-MPGC 255

  Fly   264 K------------MFANLRDMQNTNPVSCSHSAAAIFFRQS-MDPEYPFVGYECGSYREFAAGYC 315
            |            :::..||.     |:|:|..:..::.:| ::|: .|..|.|.||::|.:..|
  Rat   256 KKNALSQIVDIDGIWSGTRDF-----VACNHLRSYKYYLESILNPD-GFAAYPCASYKDFESNKC 314

  Fly   316 ----------DGNRKARFGIHSQRRAQGSFYFRTAPQQPYVPRRQTNWLSGVGRMSSSKV 365
                      .|:...:|...|....| .|:..|...:.:...|....|...|||.:.:|
  Rat   315 FPCPDQGCPQMGHYADKFAGKSGDEPQ-KFFLNTGEAKNFARWRYRVSLILSGRMVTGQV 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 93/294 (32%)
Pnliprp1NP_114470.1 Lipase 18..353 CDD:395099 93/298 (31%)
PLAT_PL 356..467 CDD:238857 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.