DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and CG34448

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001097059.1 Gene:CG34448 / 5740554 FlyBaseID:FBgn0085477 Length:344 Species:Drosophila melanogaster


Alignment Length:270 Identity:75/270 - (27%)
Similarity:115/270 - (42%) Gaps:36/270 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PNKKLALFLHGWNDQGSKDWVQELLLTWTLFDSN-YNVCVVDWGNL---------SQNDYKSASM 145
            |...|.:.:||:  .|:::....|.:...|..:. .||..||:|.|         :.|:....|.
  Fly    72 PRLPLKILIHGF--IGNRNLTPNLEVRDVLLQTQPINVISVDYGTLVRWPCYYPWAVNNAPIVSE 134

  Fly   146 SIFDV--GLTVAGIIMALEELRPNHFHRSNVTLAGYSLGAHAAGYAGAVLEGQVEQIIGLDPAGP 208
            .:..:  .|..|||           ..|.::.|.|:||||..||.....:...:.:|.|||||||
  Fly   135 CLAQMINNLISAGI-----------SRREDIHLIGFSLGAQVAGMVANYVSQPLARITGLDPAGP 188

  Fly   209 LFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSLGTSLKCGHADFYPNGGRAPQTNCKMFANLRDMQ 273
            .|.:...:..|  ||..||.||.::||...........||||||||..:..|..|...:|.|.  
  Fly   189 GFMMQPSLQQK--LDASDADFVDIIHTDPFFFSMLPPMGHADFYPNLDQLNQRGCSYISNWRF-- 249

  Fly   274 NTNPVSCSHSAAAIFFRQSMDPEYPFVGYECGSYREFAAGYC---DGNRKARFGIHSQRRAQGSF 335
                .:|:|..||:::.:|:..|..|...:||.:.:|.:..|   ......:.|......|.||:
  Fly   250 ----YNCNHYRAAVYYGESIISERGFWAQQCGGWFDFFSQRCSHYSNMPNTQMGYFVSEDASGSY 310

  Fly   336 YFRTAPQQPY 345
            :..|....|:
  Fly   311 FLTTHEVAPF 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 74/264 (28%)
CG34448NP_001097059.1 Pancreat_lipase_like 44..316 CDD:238363 74/264 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.