DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and CG6271

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster


Alignment Length:343 Identity:102/343 - (29%)
Similarity:151/343 - (44%) Gaps:56/343 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VPRIEAFHRWSPMMKAFRYL--QETMLRNSLERAHLN-------------HGIVFECRTISAKDF 70
            ||:.:....|..|..|..::  ||.:....|....:|             | |....::||..:|
  Fly    33 VPQQDGSFEWVDMDVAEEWMEAQEKLEGRGLTTVPVNFYLFTPKNPSSSKH-IYATTKSISKSNF 96

  Fly    71 GNEVHFNLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKDWVQELLLTWTLFDSNYNVCVVDWGNL 135
             |..|               |.:   ..:|||..........::...: |...:|||.||||...
  Fly    97 -NPAH---------------PTR---FVIHGWTQSYLNSMNSDIRKAF-LSKGDYNVIVVDWARA 141

  Fly   136 SQNDYKSASMSIFDVGLTVAGIIMALEELRPNH-FHRSNVTLAGYSLGAHAAGYAGAVLEGQVEQ 199
            ...||.::.|::...|..||.:|..|::   || .:.::|.:.|:|||||.|||||...:|||..
  Fly   142 RSVDYATSVMAVAATGKKVAKMINFLKD---NHGLNLNDVYVIGHSLGAHVAGYAGKNTDGQVHT 203

  Fly   200 IIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSLGTSLKCGHADFYPNGGRAPQTNCK 264
            |||||||.||||..   .|..||:..||.:|:.:.|:||:||.....|...||||||:. |..|.
  Fly   204 IIGLDPALPLFSYN---KPNKRLNSDDAWYVESIQTNGGTLGFLKPIGKGAFYPNGGKT-QPGCP 264

  Fly   265 MFANLRDMQNTNPVSCSHSAAAIFFRQSMDPEYPFVGYECGSYREFAAGYCDGN-RKARFGIHSQ 328
            :     |:..    :|||..:..::.:::. |..|...:||.|.|..|..|... ...|.|..:.
  Fly   265 L-----DVTG----ACSHGRSTTYYAEAVS-EDNFGTMKCGDYEEAVAKECGSTYSSVRMGADTN 319

  Fly   329 R-RAQGSFYFRTAPQQPY 345
            . ..:|.||.....:.|:
  Fly   320 AYMVEGDFYVPVNSKAPF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 88/276 (32%)
CG6271NP_651526.1 Lipase 57..337 CDD:278576 94/317 (30%)
Pancreat_lipase_like 68..333 CDD:238363 93/302 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.