DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and CG17192

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster


Alignment Length:345 Identity:92/345 - (26%)
Similarity:140/345 - (40%) Gaps:62/345 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VPRIEAFHRWSPMMKAFRYLQETMLRNSLERAHLNHGIVFECRTISAKDFGNEV----------H 75
            ||:.:...:|.....|     :.:|.|.......::.:.|...|......|.|:          |
  Fly    31 VPQEDGTFQWMDKKDA-----KELLENISPLEFRSNEVSFYLYTKQNPTEGQEITADASSIVASH 90

  Fly    76 FNLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKDWVQELLLTWTLFDSNYNVCVVDWGNLSQNDY 140
            ||...|             ....:|||..:.:.....::...| |...::||.||:|......||
  Fly    91 FNKDHG-------------TRFVIHGWKGKYTDSMNVDITKAW-LSKGDFNVIVVNWARSQSVDY 141

  Fly   141 KSASMSIFDVGLTVAGIIMALEELRPNH-FHRSNVTLAGYSLGAHAAGYAG-AVLEGQVEQIIGL 203
            ..:..::...|..|..:|..:.|   || .....:.:.|:|||||.||||| .|.:.:|..|:||
  Fly   142 AMSVRAVPGAGTKVGEMIQYMHE---NHDMSLETLEVIGHSLGAHVAGYAGKQVGQKRVHTIVGL 203

  Fly   204 DPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSLGTSLKCGHADFYPNGGRAPQTNCKMFAN 268
            |||.||||..   .|..||...||.:|:.:.|:||..|.....|.|.||.:||| .|..|.:   
  Fly   204 DPALPLFSYD---NPDKRLSSEDAFYVESIQTNGGVKGFVKPIGKAAFYVSGGR-KQPGCGV--- 261

  Fly   269 LRDMQNTNPVSCSHSAAAIFFRQSMDPEYPFVGYECGSYREFAAGYCDGNRKARFGIHSQRRA-- 331
              |:..|    |||:.:.|::.::: .|..|...:|..|:......|..:      ..|.|.|  
  Fly   262 --DLAGT----CSHARSVIYYAEAI-TENSFGAIQCQDYQAALDNECGSS------FSSVRMAED 313

  Fly   332 ------QGSFYFRTAPQQPY 345
                  :|.||.....:.|:
  Fly   314 TNAYNVEGHFYVPVNSEAPF 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 83/293 (28%)
CG17192NP_651522.1 Lipase 55..333 CDD:278576 85/314 (27%)
Pancreat_lipase_like 62..329 CDD:238363 85/303 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.