DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and CG6295

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_651521.1 Gene:CG6295 / 43247 FlyBaseID:FBgn0039471 Length:338 Species:Drosophila melanogaster


Alignment Length:370 Identity:112/370 - (30%)
Similarity:162/370 - (43%) Gaps:72/370 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLGCLLCLL----------GD----VPRIEAFHRWSPMMKAFRYLQETMLRNSLERAHLNHGIV 59
            |.|....|:|          |:    ||:.:....|.....|..||:   .:|.:|..::.:.:.
  Fly     4 LFLALAFCVLAANAVEVRVNGENGWYVPQADGTMEWMDREFAEAYLE---TKNRMEGRNVLNPVT 65

  Fly    60 FECRTISAKDFGNEV----------HFNLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKD----- 109
            |...|.|.::...|:          |||             ||......:|||:  .|||     
  Fly    66 FYLYTNSNRNSPQEIKATSASISGSHFN-------------PNHPTRFTIHGWS--SSKDEFINY 115

  Fly   110 WVQELLLTWTLFDSNYNVCVVDWGNLSQNDYKSASMSIFDVGLTVAGIIMALEELRPNH-FHRSN 173
            .|::...|    ..:.|:..||||.....||.|:.:::..||..||.:|   ..:|.|| .:..|
  Fly   116 GVRDAWFT----HGDMNMIAVDWGRARSVDYASSVLAVPGVGEQVATLI---NFMRSNHGLNLDN 173

  Fly   174 VTLAGYSLGAHAAGYAGA-VLEGQVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSG 237
            ..:.|:|||||.:||||. |..||:..|||||||.||||..   :|..||...||.:|:.:.|:|
  Fly   174 TMVIGHSLGAHVSGYAGKNVKNGQLHTIIGLDPALPLFSYD---SPNKRLSSTDAYYVESIQTNG 235

  Fly   238 GSLGTSLKCGHADFYPNGGRAPQTNCKMFANLRDMQNTNPVSCSHSAAAIFFRQSMDPEYPFVGY 302
            |:||.....|...||||||:: |..|.:     |:..    ||:||.:.|::.:|: .|..|...
  Fly   236 GTLGFLKPIGKGAFYPNGGKS-QPGCGV-----DLTG----SCAHSRSVIYYAESV-TENNFPTM 289

  Fly   303 ECGSYREFAAGYCDGN-RKARFGIHSQR-RAQGSFYFRTAPQQPY 345
            .||.|.|..|..|..: ...|.|..:.. ...|.:|.......||
  Fly   290 RCGDYEEAVAKECGSSYSSVRMGATTNAYMVAGDYYVPVRSDAPY 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 94/292 (32%)
CG6295NP_651521.1 Pancreat_lipase_like 64..330 CDD:238363 97/301 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.