DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and CG10116

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_648652.1 Gene:CG10116 / 39515 FlyBaseID:FBgn0036367 Length:289 Species:Drosophila melanogaster


Alignment Length:234 Identity:72/234 - (30%)
Similarity:104/234 - (44%) Gaps:54/234 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 NVCVVDWGNLSQ-NDYKSASMSIFDVGLTVAGIIMALEELRPNHFHR--SNVTLAGYSLGAHAAG 187
            |:..||   ||: ||    ...|.|   :||.:::.|.    |.|..  ..:.:.|::.|||.||
  Fly    86 NIISVD---LSEAND----ETEIID---SVASLVIVLH----NQFDMPLDRILVVGFAEGAHLAG 136

  Fly   188 YAGAVLE----GQVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSLGTSLKCGH 248
            ...|.::    .|:.||..|||     |..||:  .::|...||:||:|:||:.|..||..:.||
  Fly   137 GVAAKVQQDLGRQLSQITALDP-----SSGAEL--DHKLSQADAEFVEVVHTNAGGEGTWERLGH 194

  Fly   249 ADFYPNGGRAPQTNCKMFANLRDMQNTNPVSCSHSAAAIFFRQSMDPEYPFVGYECGSYREFAAG 313
            .|:|||||:. |..|          .|:  ||||..|.....:...||..||...|||....:|.
  Fly   195 VDYYPNGGQT-QPGC----------TTD--SCSHERAFELLAEMWSPENDFVSARCGSVETLSAS 246

  Fly   314 YCDGNRKARFGIH-------SQRRAQGSFYFRTAPQQPY 345
            .|      |:..|       .::.|.|.::..|....|:
  Fly   247 SC------RWSTHKMGQKQEEEQPASGIYFLETRQSSPF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 71/228 (31%)
CG10116NP_648652.1 Abhydrolase 24..274 CDD:304388 70/227 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.