DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and lipca

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_957316.1 Gene:lipca / 393997 ZFINID:ZDB-GENE-040426-1361 Length:514 Species:Danio rerio


Alignment Length:288 Identity:91/288 - (31%)
Similarity:135/288 - (46%) Gaps:33/288 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 DLRGFRRLDPNKKLALFLHGWNDQGSKD-WVQELLLTWTLFDSNYNVCVVDWGNLSQNDYKSASM 145
            |..||....|   ||:.:|||:..|..: |:..|.......:.|.||.:.||..|:...|..|:.
Zfish    70 DACGFNSSLP---LAIIIHGWSVDGMMEKWISRLASALKSSEGNINVLIADWLTLAHQHYPIAAQ 131

  Fly   146 SIFDVGLTVAGIIMALEELRPNHFHRSNVTLAGYSLGAHAAGYAGA--VLEGQ-VEQIIGLDPAG 207
            :...||..:|.::..||:.:  .|....|.|.|||||||.:|:||:  .:.|: :.:|.||||||
Zfish   132 NTRIVGQDIAHLLSWLEDFK--QFPLGKVHLIGYSLGAHISGFAGSNLAMSGRTLGRITGLDPAG 194

  Fly   208 PLFSLPAEVAPKYRLDPGDAQFVQVLHT-----SGGSLGTSLKCGHADFYPNGGRAPQTNCKM-- 265
            |:|.   .::...||.|.||:||..:||     .|.|:|......|.||||||| :.|..|::  
Zfish   195 PMFE---GMSHTDRLSPEDAKFVDAIHTFTLQRMGLSVGIKQPVAHFDFYPNGG-SFQPGCQLHM 255

  Fly   266 ---FANLRD---MQNTNPVSCSHSAAA-IFFRQSMDPEYPFVGYECGSYREFAAGYCDGNRKAR- 322
               :|:|..   |.....|.|:|..|. :|....::.:...:.|:|.....|..|.|...||.| 
Zfish   256 QNIYAHLAQHGIMGFEQTVKCAHERAVHLFIDSLLNKDKQIMAYKCSDNTAFDKGNCLDCRKNRC 320

  Fly   323 ----FGIHSQRRAQGS-FYFRTAPQQPY 345
                :.|...|..:.. .:.:|....||
Zfish   321 NTLGYDIKKVRTGKSKRLFLKTRSHMPY 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 89/282 (32%)
lipcaNP_957316.1 lipo_lipase 44..488 CDD:132274 91/288 (32%)
Pancreat_lipase_like 54..344 CDD:238363 89/282 (32%)
PLAT_LPL 351..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.