DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and CG10163

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_648042.1 Gene:CG10163 / 38728 FlyBaseID:FBgn0035697 Length:378 Species:Drosophila melanogaster


Alignment Length:323 Identity:77/323 - (23%)
Similarity:127/323 - (39%) Gaps:80/323 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RAHL----NHGIVFECRTIS-AKDFGNEVHFNLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKDW 110
            |.|:    |..:....::|| .|||.                 ::|.:|..::::.::...|...
  Fly    83 RLHVMTITNQSVELPIKSISQIKDFD-----------------INPERKTLIYVNAFHTADSYFS 130

  Fly   111 VQELLLTWTLFDS---NYNVCVVDWG------------NLSQNDYKSASM--SIFDVGLTVAGII 158
            |||.|   ||..:   :.||.|||:.            :||.|.|....:  ::.|.|:.|    
  Fly   131 VQEHL---TLLQNSRRDLNVIVVDFAKDVAQLYYAVRHHLSVNGYFVYKLLRALKDAGIAV---- 188

  Fly   159 MALEELRPNHFHRSNVTLAGYSLGAHAAGYAGAVLEGQVEQIIG----LDPAGPLFSLPAEVAPK 219
                         .::||||:|:||:.|.....:...:.:|::|    :|||  ......::..|
  Fly   189 -------------QDITLAGHSVGANIAALGAQLFAKENKQLVGQLLAIDPA--TMCRTTDILVK 238

  Fly   220 YRLDPGDAQFVQVLHTSGGSLGTSLKCGHADFYPNG-GRAPQTNCKMFANLRDMQ-NTNPVSCSH 282
            ..:    |..|.|||..|...|..:..||.|.|||| |..|:         |.:| ......|||
  Fly   239 QSV----ALRVVVLHGEGDVFGVRVPLGHIDIYPNGIGYFPR---------RKLQPGCESKICSH 290

  Fly   283 SAAAIFFRQSMDPEYPFVGYECGSYREFAAGYCDGNRKARFGIHSQRRAQGSFYFRTAPQQPY 345
            ....|.|.:::.........:|.|:.:|..|.|:.......|:.....|:|.::..|.|..|:
  Fly   291 MYPFILFMEALIEGVMIPATKCESWAKFRQGDCNFQNTINIGLIYPANAKGLYFCMTQPNPPF 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 70/296 (24%)
CG10163NP_648042.1 Abhydrolase 91..349 CDD:304388 73/309 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.