DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and CG13562

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001246484.1 Gene:CG13562 / 37797 FlyBaseID:FBgn0034928 Length:342 Species:Drosophila melanogaster


Alignment Length:394 Identity:80/394 - (20%)
Similarity:135/394 - (34%) Gaps:102/394 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 HLLLLGCLLCLLGDVPRIEAFHRWSPMMKAFRYLQETMLRNSLERAHLNH--GIVFEC-RTISAK 68
            |.:|:.|.:.|      |:..|  |.:...:..|::.....:.:...|.|  .|.::. :|:...
  Fly     8 HSILIVCCVLL------IDGTH--SKLNLKYAILRQKQAAKATQNDTLAHQQRIKYDAQKTMKVM 64

  Fly    69 DFGN-----EVHFNLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKDWVQELLLTWTLFDSNYNVC 128
            .:.|     |........||.| ....|..|.|:.||||....|.:|...|:...:.:.....:|
  Fly    65 FYKNNTKTMETSAYDDAYDLSG-SGCSPTDKFAIVLHGWIQSCSDEWALSLIERLSYYRGGCVIC 128

  Fly   129 VVDWGNLSQNDYKSASMSIFDVGLTVAGIIMALEELRPNHFHRSNVTLAGYSLGAHAAGYAGAVL 193
             :|:..::.:.|.....:...:...::.||:.|..   ..|......:.|:|.|...|...|..|
  Fly   129 -IDYSVVASSSYMRLYTNFDTLTGAISSIILTLFR---QGFDPKRGYMFGFSFGGQLASAVGRSL 189

  Fly   194 EGQ--VEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSLGTSLKCGHADFYPNGG 256
            ...  :|.|...|.|||.|            ||     :.|.|:..|.   .::|.|:.      
  Fly   190 RPHHIIESIDTCDMAGPGF------------DP-----IAVDHSKAGK---HVQCFHSS------ 228

  Fly   257 RAPQTNCKMFANLRDMQNTNPVSC-----------------------SHSAAAIFFRQSMDPEYP 298
                         || :.|...||                       ||......:..:.|  ||
  Fly   229 -------------RD-KGTFVYSCHRNIMLGSCGLKQPSVASQLHLGSHGLCVDIYINTFD--YP 277

  Fly   299 F--VGY---ECGSYREFAA---GYCDGNRKARFGIHSQRRAQGSFYFRTAPQQPY-VPRRQTNWL 354
            |  |.|   ||.::::.|.   ||..|..:     :...:..|..:..|:...|| :.::|...|
  Fly   278 FYAVNYTPPECFTWQKTAKIPDGYTVGYEE-----NFDSQVTGQIFVPTSLHYPYNLSKKQLKLL 337

  Fly   355 SGVG 358
            :..|
  Fly   338 TKGG 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 63/311 (20%)
CG13562NP_001246484.1 Abhydrolase 64..>208 CDD:304388 34/148 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.