DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and CG6472

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster


Alignment Length:372 Identity:113/372 - (30%)
Similarity:165/372 - (44%) Gaps:64/372 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RNSLERAHLNHGIVFECRTISAKDFGNEVHFNLQLGDLRGFRRLDPNKKLALFLHGWNDQ--GSK 108
            |||.:..||:.    :.|...:       :||.             |..||::|||:::.  |.:
  Fly    54 RNSAQLLHLSD----DARLAQS-------NFNF-------------NYPLAIYLHGFSESATGER 94

  Fly   109 DWVQELLLTWTLFDSNYNVCVVDWGNLSQNDYKSASMSIFDVGLTVAGIIMA--LEELRPNHFHR 171
            ...|||...: |...||||.::||..::...:.|.::.    .|.|:|..:|  |..|....:..
  Fly    95 QSSQELKDAF-LRRGNYNVILIDWSAMTAVPWYSNAVE----NLPVSGRYLARFLRFLVDKGYPA 154

  Fly   172 SNVTLAGYSLGAHAAGYAGAVLEG---QVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVL 233
            ..:.|.|:||||..||:||..|:.   ::.:|..||||.|||.   ..:...||.|.||:||.|:
  Fly   155 KYIHLIGFSLGAEVAGFAGKQLQEWGIKLPRITALDPALPLFE---GNSSNRRLSPSDARFVDVI 216

  Fly   234 HTSGGSLGTSLKCGHADFYPNGGRAPQTNCKMFANLRDMQNTNPVSCSHSAAAIFFRQSMDPEYP 298
            ||.||.||.....|||||||||||..|..|.. .|:.:......|.|||..|..:|.:|:.....
  Fly   217 HTDGGLLGNPAPMGHADFYPNGGRPLQPGCAK-QNIANNWLGIIVGCSHQRAWEYFVESIAQPRG 280

  Fly   299 FVGYECGSYREFAAGYC--DGNRKARFGIHSQRRAQGSFYFRTAPQQPYVPRRQTNWLSGVGRMS 361
            |....|.....|  |.|  .|...|..|:.:..|.:|.||..|...:|:            ||.|
  Fly   281 FPAQRCEPSDMF--GICREPGGGPAFMGMGADPRIRGKFYLDTNDAKPF------------GRNS 331

  Fly   362 SSK--VSQVSQSPLVLRLWTNSWRRRERAR------ERQRRDRDRES 400
            .::  ||...:.|:..:|..|:.|:...:|      |:...|.|..:
  Fly   332 RARAIVSLAPRLPIAYKLPPNATRQPSVSRWANGQKEQDNEDEDNNA 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 93/282 (33%)
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 99/303 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7922
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.