DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and CG17292

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster


Alignment Length:335 Identity:90/335 - (26%)
Similarity:148/335 - (44%) Gaps:49/335 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 MMKAFRYLQETM--LRNSLERAHLNHG--IVFECRTISAKDFGNEVHFNLQLGDLRGFRRLDPNK 93
            |.||.:.....:  |:||  :|.|...  |::...|::..|..:...|...|.|    ..||..|
  Fly     1 MHKAIKNKSRLLCGLKNS--KADLTTAKFILYYGPTVADSDIYDLTDFQSLLED----EHLDLGK 59

  Fly    94 KLALFLHGWNDQGSKDWVQELLLTWTLFDSNYNVCVVDWGNLSQNDYK-SASMSIFDVGLTVAGI 157
            ...|:|||:.:....:.:..:...: |...:.|:.|:|||.|:..:|. .|..::..:|..:|.:
  Fly    60 NTVLYLHGYLEDPDVESIHVIAEAY-LERKDTNLIVLDWGELADGNYMFDAFPNLKQLGPELAKV 123

  Fly   158 IMALEE--LRPNHFHRSNVTLAGYSLGAHAAGYAGAVL----EG--QVEQIIGLDPAGPLFSLPA 214
            ::.:.:  |....||     :.|:|:|...||..|..:    :|  ::::|..||||.|||    
  Fly   124 LLKMFDHGLDIEKFH-----IVGHSMGGQLAGLLGREITKRTKGVRKIKRISALDPAFPLF---- 179

  Fly   215 EVAPKYRLDPGDAQFVQVLHTSGGSLGTSLKCGHADFYPNGGRA-----PQTNCKMFANLRDMQN 274
              .|...|...||:||.|:||.....|.....|.|||:||||.:     |:.|.||.::      
  Fly   180 --YPGTHLSANDAEFVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKRNYKMLSD------ 236

  Fly   275 TNPVSCSHSAAAIFFRQSMDPEYPFVGYE---CGSYREFAAGYCDGN-RKARFGIHSQRRAQGSF 335
             |.:| ||..:..|:.:|:...|| :|::   ...:.:|.......| .....|.|......|.|
  Fly   237 -NDLS-SHRRSWWFWAESVSDRYP-IGFDAVPAKKWSDFKQNKIVENCPPVVMGHHCPTTIHGDF 298

  Fly   336 YFRTAPQQPY 345
            |.:|....|:
  Fly   299 YLQTNGHTPF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 79/291 (27%)
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 80/304 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.