DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and CG18641

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster


Alignment Length:293 Identity:82/293 - (27%)
Similarity:119/293 - (40%) Gaps:62/293 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 HFNLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKDWVQELLLTWTLFD-SNYNVCVVDWGN---- 134
            |||             |.....:.:||:.  |.:.......|....|. ..||:.:||:.:    
  Fly    98 HFN-------------PRHPTKIIIHGFG--GGRTLSPSPDLREAYFSVGEYNIIIVDYADAVKE 147

  Fly   135 --LSQNDYKSASMSIFDVGLTVAGIIMALEE----LRPNHFHRSNVTLAGYSLGAHAAGYAGAVL 193
              |||.|:.....|     |.::.::..|..    ::|:..|     ..|||:|||.||.....|
  Fly   148 PCLSQMDWAPRFGS-----LCISQLVKYLARHPRGVQPDDLH-----FIGYSVGAHIAGLVANYL 202

  Fly   194 ---EGQVEQIIGLDP-----AGPLFSLPAEVAPKYR-LDPGDAQFVQVLHTSGGSLGTSLKCGHA 249
               ||::.:|..|||     ||         |...| ||..||.||.||||..|.||.....|||
  Fly   203 KPEEGKLGRITALDPTIFFYAG---------ANNSRDLDSTDAHFVDVLHTGAGILGQWHSSGHA 258

  Fly   250 DFYPNGGRAPQTNCKMFANLRDMQNTNPVSCSHSAAAIFFRQSMDPEYPFVGYECGSYREFAAGY 314
            |||.||| ..|..|...|.|     ...::|.|:....:|.:|:.....|....|.:...:..|:
  Fly   259 DFYVNGG-TRQPACVGSATL-----FQTLACDHTKVTPYFIESITTTRGFYAGPCPNLFSYLIGW 317

  Fly   315 CD--GNRKARFGIHSQRRAQGSFYFRTAPQQPY 345
            |:  .:.....|.|...:|:|::|..|..:.|:
  Fly   318 CEPKDSEYVLMGEHCSHKARGNYYVTTNAKAPF 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 81/287 (28%)
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 81/287 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.