DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and CG6847

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001285397.1 Gene:CG6847 / 32778 FlyBaseID:FBgn0030884 Length:1000 Species:Drosophila melanogaster


Alignment Length:357 Identity:107/357 - (29%)
Similarity:162/357 - (45%) Gaps:61/357 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 MMKAFRYLQETML----------RNSLERAHLNHGIVFECRTISAKDFGNEVHFNLQLGDLRGFR 87
            |..|||..:||.:          |:|:..|..:...|......:.:..|.:......:.||.||.
  Fly   124 MTNAFRGKRETEVSTSSPEGTSGRSSVASAPSSMSAVNATTFTTERPGGGQKKPTPSIDDLEGFD 188

  Fly    88 RLDPNKKLALFLHGWNDQGSKDWVQELLLTWTLFDSNYNVCVVDWGN-LSQNDYKSASMSIFDVG 151
            .|    .:.:.:||:.......|:.|:.......:....:| |||.| .:..:|..|:.:...||
  Fly   189 EL----SVRVIVHGFGSACPHVWIYEMKTALMAVEDCIVIC-VDWENGATFPNYVRAAANTRLVG 248

  Fly   152 LTVAGIIMALEELRPNHFHRSNVTLAGYSLGAHAAGYAGAVLEGQVEQIIGLDPAGPLFSLPAEV 216
            ..:|.::..|::.:.....|::|  .|:|||||.:|:|||.|.| :.:|.|||||||||...   
  Fly   249 KQLAMLLRNLQQHKGLDLMRTHV--IGFSLGAHVSGFAGAELPG-LSRITGLDPAGPLFEAQ--- 307

  Fly   217 APKYRLDPGDAQFVQVLHTSG-----GSLGTSLKCGHADFYPNGGRAPQTNCKMFANL------- 269
            .||.|||..||:||.|:|::|     |.||:....||.|:||||||. ||.|   :||       
  Fly   308 HPKVRLDSSDAEFVDVIHSNGENLILGGLGSWQPMGHVDYYPNGGRV-QTGC---SNLFVGAVTD 368

  Fly   270 --------RDMQNTNPVSCSHSAAAIFFRQSMDPEYPFVGYECGSYREFAAGYC----------- 315
                    .|.:..:  .|:|..|..||..|:.|...|..:.||:|.:|..|.|           
  Fly   369 FIWSAQAAEDEEGRS--LCNHRRAYKFFIDSVAPRCLFPAFPCGNYDDFLKGRCFPCAQDDEDLA 431

  Fly   316 DG-NRKARFGIHSQR-RAQGSFYFRTAPQQPY 345
            :| .|....|.::.| ..:|..|..|..::|:
  Fly   432 EGVPRCGNMGYYADRSTGRGQLYLLTREEEPF 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 96/307 (31%)
CG6847NP_001285397.1 Lipase 70..463 CDD:278576 106/355 (30%)
Pancreat_lipase_like 185..459 CDD:238363 93/290 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.