DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and CG5162

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster


Alignment Length:344 Identity:87/344 - (25%)
Similarity:135/344 - (39%) Gaps:89/344 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 NEVHFNLQLG-DLRGFRRLDP-----------NKKLALFLHGWND--QGSKDWVQELLLTWTLFD 122
            |:::|.||.. :.:.|....|           .||:.:...||..  .||.        |..:|.
  Fly    98 NKMNFQLQTACEKKNFPLTSPESMWKSPLFDVKKKVVILATGWTTTVNGSD--------TIEVFS 154

  Fly   123 SNYNVC-------VVDWGNLSQNDYKSASMSIFDVGLTVAGIIMALEELRPNHFHRSNVTLAGYS 180
            ..|| |       .||........|..::.:..::|..:|..::.|.:|.|    ..|:.|.|:|
  Fly   155 KAYN-CRGDVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLLDLVP----VENIHLIGHS 214

  Fly   181 LGAHAAGYAGAVLEGQVEQ----IIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSLG 241
            ||||..|.||..|:....|    |.|||||.|.|:....::...|   |||.||.|:|::.|.||
  Fly   215 LGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMR---GDAHFVDVIHSNPGVLG 276

  Fly   242 TSLKCGHADFYPNGGRAP-QTNCKMFANLRDMQNTNPVSCSHSAAAIFFRQSMDP--EYPFVGYE 303
            .....|..|||| ||.:| ...|  |:          |:|:|:.:..:|.:::.|  |..|:...
  Fly   277 KRDPVGDVDFYP-GGMSPLAAGC--FS----------VTCAHARSWEYFAETVFPGNERNFMATR 328

  Fly   304 CGSYREFAAGYCDGNRKARFGIHSQRRAQGSFYFRTAPQQPY----------------------- 345
            |.|..:.....|.|: :...|....:..:|:::...:...|:                       
  Fly   329 CNSISKLRDFRCPGD-EVPMGYAVPQNIKGNYFLEVSASAPFGMHASVVRSAHLEHCGLCPESTS 392

  Fly   346 ---VPRRQT-----NWLSG 356
               ||...|     :|.||
  Fly   393 TTEVPSTTTTGKPGSWFSG 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 80/296 (27%)
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 80/300 (27%)
Pancreat_lipase_like 99..365 CDD:238363 79/295 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.