DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and CG18258

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster


Alignment Length:289 Identity:88/289 - (30%)
Similarity:131/289 - (45%) Gaps:57/289 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 QLGDLRGFRRLDPNKKLALFLHGW----NDQGSKDWVQELLLTWTLFDSNYNVCVVDWGNLSQND 139
            ||.:..||.:   ::...||:.||    |:..|....:..|..     ::.||.::|..|.....
  Fly   194 QLWNTTGFYQ---DRPTVLFITGWTTSINNSNSGPVAKAYLCR-----NDTNVLILDAANFIDTL 250

  Fly   140 YKSASMSIFDVGLTVAGIIMALEELRPN------HFHRSNVTLAGYSLGAHAAGYAG----AVLE 194
            |..::::     ..|.|..:|...||.|      .||     |.|:||||..||.||    .:..
  Fly   251 YTWSALN-----TEVIGDYLAKALLRLNTSYVTKQFH-----LVGHSLGAQIAGSAGRNYRRLSG 305

  Fly   195 GQV-EQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSLGTSLKCGHADFYPNGGRA 258
            ||: ::|.|||||.|.|....|:.   .|..|||:||.::||:.|..|||.:.|.|||:.. ||.
  Fly   306 GQILKRITGLDPANPCFYDGNELE---GLRSGDARFVDIIHTNPGMFGTSKRAGDADFFVQ-GRI 366

  Fly   259 P-QTNCKMFANLRDMQNTNPVSCSHSAAAIFFRQSMDPEYP-----FVGYECGSYREFAAG-YCD 316
            | :..|         ::.:|:||||..|..::.:::   ||     |:...|..|.|...| ||.
  Fly   367 PFKPGC---------ESLDPISCSHQRAVDYWTETV---YPSNGNDFLAKRCKRYSELLLGNYCK 419

  Fly   317 GNRKARFGIHSQRRAQGSFYFRTAPQQPY 345
             |.....|..::....|.||....|::||
  Fly   420 -NTNTVMGYAAKATDLGLFYVGANPEEPY 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 85/283 (30%)
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 85/283 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.