DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and Yp3

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster


Alignment Length:349 Identity:83/349 - (23%)
Similarity:130/349 - (37%) Gaps:89/349 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 ETMLRNSLERAHLNHGIVFECRTISAKDFG-NEVHFNLQLGDLRGFRRLDPNKKLAL------FL 99
            |..|.|.:|.|....|            || :||..     .|.|..:..|.::.|:      ::
  Fly   102 ECKLNNYVETAKAQPG------------FGEDEVTI-----VLTGLPKTSPAQQKAMRRLIQAYV 149

  Fly   100 HGWNDQGSKDWVQELLLTWTLFDSNY------------------NVCVVDWGNLSQNDYKSASMS 146
            ..:|.|..:...||........|.:|                  ::.::|.|:...|..:.|.:.
  Fly   150 QKYNLQQLQKNAQEQQQQLKSSDYDYTSSEEAADQWKSAKAASGDLIIIDLGSTLTNFKRYAMLD 214

  Fly   147 IFDVGLTVAGIIMALEELRPNHFHRSNVTLAGYSLGAHAAGYAGAVLEGQ----VEQIIGLDPAG 207
            :.:.|   |.|...|.:|......:..:.|.|..:.||.||.||.....|    :.:|.|||||.
  Fly   215 VLNTG---AMIGQTLIDLTNKGVPQEIIHLIGQGISAHVAGAAGNKYTAQTGHKLRRITGLDPAK 276

  Fly   208 PLFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSLGTSLKCGHADFYPNGGRAPQTNCKMFANLRDM 272
            .|...|..:.   .|..|||.||..:|||..::||.::||..||||||   |.|......|:.: 
  Fly   277 VLSKRPQILG---GLSRGDADFVDAIHTSTFAMGTPIRCGDVDFYPNG---PSTGVPGSENVIE- 334

  Fly   273 QNTNPVSCSHSAAAIFFRQSMDPEYPFVGYECGSYREFAA-------------GYCDGNRKARFG 324
                    :.:.|..:|.:|:.|         ||.|.|.|             |:   .::|..|
  Fly   335 --------AVARATRYFAESVRP---------GSERNFPAVPANSLKQYKEQDGF---GKRAYMG 379

  Fly   325 IHSQRRAQGSFYFRTAPQQPYVPR 348
            :......:|.:......:.|:..|
  Fly   380 LQIDYDLRGDYILEVNAKSPFGQR 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 75/315 (24%)
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 81/344 (24%)
Abhydrolase <215..396 CDD:304388 57/210 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.