DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and Yp1

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster


Alignment Length:293 Identity:72/293 - (24%)
Similarity:123/293 - (41%) Gaps:65/293 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 HGWN------DQGS-----------KDWVQELLLTWTLFDSNYNVCVVDWGNLSQNDYKSASMSI 147
            ||.|      ||.:           :|:.:|:....|   .:.::.|:|.|:......:.|.:.|
  Fly   163 HGKNGNQDYQDQSNEQRKNQRTSSEEDYSEEVKNAKT---QSGDIIVIDLGSKLNTYERYAMLDI 224

  Fly   148 FDVGLTVA-GIIMALEELRPNHFHRSNVTLAGYSLGAHAAGYAG---AVLEG-QVEQIIGLDPAG 207
            ...|..:. .|:..:.||   ......:.|.|.::|||.||.|.   ..|.| ::.::.|||   
  Fly   225 EKTGAKIGKWIVQMVNEL---DMPFDTIHLIGQNVGAHVAGAAAQEFTRLTGHKLRRVTGLD--- 283

  Fly   208 PLFSLPAEVAPKYR-----LDPGDAQFVQVLHTSGGSLGTSLKCGHADFYPNGGRA--PQTNCKM 265
                 |:::..|.:     |..|||:||..:|||...:||.::.|..||||||..|  |..:..:
  Fly   284 -----PSKIVAKSKNTLTGLARGDAEFVDAIHTSVYGMGTPIRSGDVDFYPNGPAAGVPGASNVV 343

  Fly   266 FANLRDMQNTNPVSCSHSAAAIFFRQSMDP--EYPFVGYECGSYREFAAGYCDG-NRKARFGIHS 327
            .|.:|              |..:|.:|:.|  |..|......|.:::...  || .::|..||.:
  Fly   344 EAAMR--------------ATRYFAESVRPGNERSFPAVPANSLQQYKQN--DGFGKRAYMGIDT 392

  Fly   328 QRRAQGSFYFRTAPQQPY---VPRRQTNWLSGV 357
            ....:|.:..:..|:.|:   .|.::.:...||
  Fly   393 AHDLEGDYILQVNPKSPFGRNAPAQKQSSYHGV 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 67/272 (25%)
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 62/252 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.