DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and Yp2

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001285070.1 Gene:Yp2 / 31938 FlyBaseID:FBgn0005391 Length:442 Species:Drosophila melanogaster


Alignment Length:474 Identity:103/474 - (21%)
Similarity:162/474 - (34%) Gaps:163/474 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLLGCLLCLLGDVPR--------------IEAFHRW--------SPMMK--AFRYLQE------ 42
            |.::.|||.:....|:              :|....|        .|.:|  ..:.|||      
  Fly     7 LCVMACLLAVAMGNPQSGNRSGRRSNSLDNVEQPSNWVNPREVEELPNLKEVTLKKLQEMSLEEG 71

  Fly    43 -TMLRNSLERAHLNHGIVF---------ECRTISAKDFGNEVHFNL-----------QLGDLRGF 86
             |:|......:..||  ||         :.|.....:.|.::.|||           :.||    
  Fly    72 ATLLDKLYHLSQFNH--VFKPDYTPEPSQIRGYIVGERGQKIEFNLNTLVEKVKRQQKFGD---- 130

  Fly    87 RRLDPNKKLALFLHGWND------QGSKDWVQELLLTWTLFDSNYNVC---VVDWGNL------- 135
                  .::.:|:.|..:      :.::..||       .:...||:.   ..|:.|.       
  Fly   131 ------DEVTIFIQGLPETNTQVQKATRKLVQ-------AYQQRYNLQPYETTDYSNEEQSQRSS 182

  Fly   136 -------------SQNDYKSASMSIFDVGLTVAGI-------IMALEELRPNHF----HRSNVT- 175
                         .|:|.|:..:.:..:|..:...       |..|.|:..|..    :..||. 
  Fly   183 SEEQQTQRRKQNGEQDDTKTGDLIVIQLGNAIEDFEQYATLNIERLGEIIGNRLVELTNTVNVPQ 247

  Fly   176 ----LAGYSLGAHAAGYAGAVLEGQ----VEQIIGLDPAGPLFSLPAEVAPKYRLD---PGDAQF 229
                |.|....||.||.||.....|    :.:|..|||. .::..|.|     ||.   .|||.|
  Fly   248 EIIHLIGSGPAAHVAGVAGRQFTRQTGHKLRRITALDPT-KIYGKPEE-----RLTGLARGDADF 306

  Fly   230 VQVLHTSGGSLGTSLKCGHADFYPNGGRAPQTNCKMFANLRDMQNTNPVSCSHSAAAIFFRQSMD 294
            |..:|||...:|||.:..:.||:|||   |.|.         :...:.|..:...|..:|.:|:.
  Fly   307 VDAIHTSAYGMGTSQRLANVDFFPNG---PSTG---------VPGADNVVEATMRATRYFAESVR 359

  Fly   295 P--EYPFVGYECGSYREFA--AGYCDGNRKARFGIHSQRRAQGSFYFRTAPQQPY---VP-RRQT 351
            |  |..|......||:|:.  .||   .::...||.:....||.:..:...:.|:   .| ::||
  Fly   360 PGNERNFPSVAASSYQEYKQNKGY---GKRGYMGIATDFDLQGDYILQVNSKSPFGRSTPAQKQT 421

  Fly   352 N-------WLSGVGRMSSS 363
            .       |     |.|||
  Fly   422 GYHQVHQPW-----RQSSS 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 75/340 (22%)
Yp2NP_001285070.1 Lipase 97..411 CDD:278576 76/351 (22%)
Abhydrolase <221..407 CDD:304388 57/206 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.