DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and Lipg

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001012759.1 Gene:Lipg / 291437 RGDID:1310740 Length:493 Species:Rattus norvegicus


Alignment Length:313 Identity:107/313 - (34%)
Similarity:143/313 - (45%) Gaps:42/313 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 IVFECRTISAKDFGNEVHFNLQLGDLR-----GFRRLDPNKKLALFLHGWNDQGS-KDWVQELLL 116
            :.|..||  :||..:| ..||.|||.:     ||   :...|....:|||...|. :.|:.:|:.
  Rat    51 VTFNIRT--SKDPEHE-GCNLSLGDSKLLENCGF---NMTAKTFFIIHGWTMSGMFESWLHKLVS 109

  Fly   117 TWTLFDSNYNVCVVDWGNLSQNDYKSASMSIFDVGLTVAGIIMALEELRPNHFHRSNVTLAGYSL 181
            .....:...||.||||..|:...|..|..:...||..|||::..|:|  ...|...:|.|.||||
  Rat   110 ALQTREKEANVVVVDWLPLAHQLYIDAVSNTRVVGRRVAGMLNWLQE--KGEFSLGDVHLIGYSL 172

  Fly   182 GAHAAGYAGAVLEGQVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHT----SGGSLGT 242
            |||.|||||..::|.|.:|.|||||||:|.   .|....||.|.||.||.||||    .|.|:|.
  Rat   173 GAHVAGYAGNFVKGTVGRITGLDPAGPMFE---GVDINRRLSPDDADFVDVLHTYTLSFGLSIGI 234

  Fly   243 SLKCGHADFYPNGGRAPQTNCKM--------FANLRDMQNTNPVSCSHSAAAIFFRQSM-DPEYP 298
            .:..||.|.|||||.. |..|..        :..:.:|     |.|.|..|...|..|: :.:.|
  Rat   235 RMPVGHIDIYPNGGDF-QPGCGFNDVMGSFAYGTISEM-----VKCEHERAVHLFVDSLVNQDKP 293

  Fly   299 FVGYECGSYREFAAGYCDGNRKAR-----FGIHSQRRAQGS-FYFRTAPQQPY 345
            ...::|.....|..|.|...||.|     :.....|:.:.| .|.:|....|:
  Rat   294 SFAFQCTDPNRFKRGICLSCRKNRCNNIGYNAKKMRKKRNSKMYLKTRAGMPF 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 103/298 (35%)
LipgNP_001012759.1 Pancreat_lipase_like 51..342 CDD:238363 106/307 (35%)
lipo_lipase 53..488 CDD:132274 107/311 (34%)
Heparin-binding. /evidence=ECO:0000250 327..339 3/11 (27%)
PLAT_LPL 349..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.