DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and Lpl

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_036730.1 Gene:Lpl / 24539 RGDID:3017 Length:474 Species:Rattus norvegicus


Alignment Length:322 Identity:110/322 - (34%)
Similarity:141/322 - (43%) Gaps:64/322 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LRNSLERAHLNHGIVFECRTISAKDFGNEVHFNLQLGDLRGFRRLDPNKKLALFLHGWNDQGS-K 108
            |.:|:...|.||         |:|.|                          :.:|||...|. :
  Rat    60 LADSVSNCHFNH---------SSKTF--------------------------VVIHGWTVTGMYE 89

  Fly   109 DWVQELLLTWTLFDSNYNVCVVDWGNLSQNDYKSASMSIFDVGLTVAGIIMALEELRPNHFHRSN 173
            .||.:|:......:.:.||.||||...:|..|..::.....||..||..|..|||  ..::...|
  Rat    90 SWVPKLVAALYKREPDSNVIVVDWLYRAQQHYPVSAGYTKLVGNDVARFINWLEE--EFNYPLDN 152

  Fly   174 VTLAGYSLGAHAAGYAGAVLEGQVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHT--- 235
            |.|.||||||||||.||::...:|.:|.|||||||.|.. || ||. ||.|.||.||.||||   
  Rat   153 VHLLGYSLGAHAAGVAGSLTNKKVNRITGLDPAGPNFEY-AE-APS-RLSPDDADFVDVLHTFTR 214

  Fly   236 --SGGSLGTSLKCGHADFYPNGGRAPQTNCKMFANLR--------DMQNTNPVSCSHSAAA-IFF 289
              .|.|:|.....||.|.|||||.. |..|.:...:|        |:...  |.|||..:. :|.
  Rat   215 GSPGRSIGIQKPVGHVDIYPNGGTF-QPGCNIGEAIRVIAEKGLGDVDQL--VKCSHERSIHLFI 276

  Fly   290 RQSMDPEYPFVGYECGSYREFAAGYCDGNRKAR-----FGIHSQRRAQGS-FYFRTAPQQPY 345
            ...::.|.|...|.|.|...|..|.|...||.|     :.|:..|..:.| .|.:|..|.||
  Rat   277 DSLLNEENPSKAYRCNSKEAFEKGLCLSCRKNRCNNVGYEINKVRAKRSSKMYLKTRSQMPY 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 101/294 (34%)
LplNP_036730.1 Interaction with GPIHBP1. /evidence=ECO:0000250|UniProtKB:P06858 32..53
lipo_lipase 33..472 CDD:132274 110/322 (34%)
Pancreat_lipase_like 37..334 CDD:238363 107/316 (34%)
Essential for determining substrate specificity. /evidence=ECO:0000250|UniProtKB:P06858 243..266 4/24 (17%)
PLAT_LPL 341..465 CDD:238856
Important for interaction with lipoprotein particles. /evidence=ECO:0000250|UniProtKB:P06858 417..421
Important for heparin binding. /evidence=ECO:0000250|UniProtKB:P06858 430..434
Interaction with GPIHBP1. /evidence=ECO:0000250|UniProtKB:P06858 443..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.