DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and LIPH

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_640341.1 Gene:LIPH / 200879 HGNCID:18483 Length:451 Species:Homo sapiens


Alignment Length:259 Identity:78/259 - (30%)
Similarity:117/259 - (45%) Gaps:38/259 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 RTISAKDFGNEVHFNLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKD-WVQELLLTWTLFDSNYN 126
            :||::..|||                |:..||....:||:...||.. |:.: |:...|...:.|
Human    55 QTINSSAFGN----------------LNVTKKTTFIVHGFRPTGSPPVWMDD-LVKGLLSVEDMN 102

  Fly   127 VCVVDWG-NLSQNDYKSASMSIFDVGLTVAGIIMALEELRPNHFHRSNVTLAGYSLGAHAAGYAG 190
            |.||||. ..:...|..||.....|.:.:...|   :::........::.:.|.|||||.:|:.|
Human   103 VVVVDWNRGATTLIYTHASSKTRKVAMVLKEFI---DQMLAEGASLDDIYMIGVSLGAHISGFVG 164

  Fly   191 AVLEGQVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSLGTSLKCGHADFYPNG 255
            .:.:|.:.:|.|||||||||:....   :.||||.|||||.|:|:...:||.....|:.||||||
Human   165 EMYDGWLGRITGLDPAGPLFNGKPH---QDRLDPSDAQFVDVIHSDTDALGYKEPLGNIDFYPNG 226

  Fly   256 G----RAPQTNCKMFANLRDMQNTNPVSCSHSAAAIFFRQSMDPEYPFVGYECGSYREFAAGYC 315
            |    ..|:|....|...:         |.|..:...:..|:........|.|.||:::..|.|
Human   227 GLDQPGCPKTILGGFQYFK---------CDHQRSVYLYLSSLRESCTITAYPCDSYQDYRNGKC 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 76/255 (30%)
LIPHNP_640341.1 Pancreat_lipase_like 39..303 CDD:238363 78/259 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.