DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and Lipg

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_034850.3 Gene:Lipg / 16891 MGIID:1341803 Length:500 Species:Mus musculus


Alignment Length:313 Identity:108/313 - (34%)
Similarity:144/313 - (46%) Gaps:42/313 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 IVFECRTISAKDFGNEVHFNLQLGDLR-----GFRRLDPNKKLALFLHGWNDQGS-KDWVQELLL 116
            :.|..||  :||...| ..||.|||.:     ||   :...|....:|||...|. :.|:.:|:.
Mouse    49 VAFNIRT--SKDPEQE-GCNLSLGDSKLLENCGF---NMTAKTFFIIHGWTMSGMFESWLHKLVS 107

  Fly   117 TWTLFDSNYNVCVVDWGNLSQNDYKSASMSIFDVGLTVAGIIMALEELRPNHFHRSNVTLAGYSL 181
            ...:.:.:.||.||||..|:...|..|..:...||..|||::..|:|  ...|...||.|.||||
Mouse   108 ALQMREKDANVVVVDWLPLAHQLYTDAVNNTRVVGQRVAGMLDWLQE--KEEFSLGNVHLIGYSL 170

  Fly   182 GAHAAGYAGAVLEGQVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHT----SGGSLGT 242
            |||.|||||..::|.|.:|.|||||||:|.   .|....||.|.||.||.||||    .|.|:|.
Mouse   171 GAHVAGYAGNFVKGTVGRITGLDPAGPMFE---GVDINRRLSPDDADFVDVLHTYTLSFGLSIGI 232

  Fly   243 SLKCGHADFYPNGGRAPQTNCKM--------FANLRDMQNTNPVSCSHSAAAIFFRQSM-DPEYP 298
            .:..||.|.|||||.. |..|..        :..:.:|     |.|.|..|...|..|: :.:.|
Mouse   233 RMPVGHIDIYPNGGDF-QPGCGFNDVIGSFAYGTISEM-----VKCEHERAVHLFVDSLVNQDKP 291

  Fly   299 FVGYECGSYREFAAGYCDGNRKAR-----FGIHSQRRAQGS-FYFRTAPQQPY 345
            ...::|.....|..|.|...||.|     :.....|:.:.| .|.:|....|:
Mouse   292 SFAFQCTDSSRFKRGICLSCRKNRCNNIGYNAKKMRKKRNSKMYLKTRAGMPF 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 104/298 (35%)
LipgNP_034850.3 Pancreat_lipase_like 49..340 CDD:238363 107/307 (35%)
lipo_lipase 51..485 CDD:132274 108/311 (35%)
Heparin-binding. /evidence=ECO:0000250 325..337 3/11 (27%)
PLAT_LPL 347..483 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.