DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and LIPI

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001289927.1 Gene:LIPI / 149998 HGNCID:18821 Length:460 Species:Homo sapiens


Alignment Length:327 Identity:101/327 - (30%)
Similarity:146/327 - (44%) Gaps:72/327 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CLLCLL---GDVPRIEAFHRWSPMMKAFRYL----QETML----RNSLERAHLNHGIVFECRTIS 66
            ||:|.:   ...|.:| |.:.| :..:||.|    .||:|    ||:|..|.    .:||     
Human     8 CLMCWVRSDNKRPCLE-FSQLS-VKDSFRDLFIPRIETILMMYTRNNLNCAE----PLFE----- 61

  Fly    67 AKDFGNEVHFNLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKD-WVQELLLTWTLFDSNYNVCVV 130
             ::....|:||.|             ||....:||:...||.. |:|..:.. .|.:.:.||.||
Human    62 -QNNSLNVNFNTQ-------------KKTVWLIHGYRPVGSIPLWLQNFVRI-LLNEEDMNVIVV 111

  Fly   131 DW---------GNLSQNDYKSA-SMSIFDVGLTVAGIIMALEELRPNHFHRSNVTLAGYSLGAHA 185
            ||         ....:|..|.| |:|:....|...|..:       ::||     ..|.|||||.
Human   112 DWSRGATTFIYNRAVKNTRKVAVSLSVHIKNLLKHGASL-------DNFH-----FIGVSLGAHI 164

  Fly   186 AGYAGAVLEGQVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSLGTSLKCGHAD 250
            :|:.|.:..||:.:|.|||||||.||   ...|..|||..||:||.|:|:....||.....||.|
Human   165 SGFVGKIFHGQLGRITGLDPAGPRFS---RKPPYSRLDYTDAKFVDVIHSDSNGLGIQEPLGHID 226

  Fly   251 FYPNGGRAPQTNC--KMFANLRDMQNTNPVSCSHSAAAIFFRQSMDPEYPFVGYECGSYREFAAG 313
            ||||||. .|..|  .:|:.::.      :.|:|..|...|..|::....|:.:.|.||:::...
Human   227 FYPNGGN-KQPGCPKSIFSGIQF------IKCNHQRAVHLFMASLETNCNFISFPCRSYKDYKTS 284

  Fly   314 YC 315
            .|
Human   285 LC 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 82/262 (31%)
LIPINP_001289927.1 Pancreat_lipase_like 41..309 CDD:238363 91/292 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.