DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and PNLIPRP3

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001011709.2 Gene:PNLIPRP3 / 119548 HGNCID:23492 Length:467 Species:Homo sapiens


Alignment Length:415 Identity:122/415 - (29%)
Similarity:170/415 - (40%) Gaps:117/415 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CLLGDVPRIEAFHR------WSPMMKAFRYL----------QETMLRNSLERAHLNHGIVFECRT 64
            |....:|....|..      |||.....|:|          ||....||              .|
Human    27 CFKDGLPWTRTFSTELVGLPWSPEKINTRFLLYTIHNPNAYQEISAVNS--------------ST 77

  Fly    65 ISAKDFGNEVHFNLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKDWVQELL-LTWTLFDSNYNVC 128
            |.|..||.:                   |...:.:.||...|.  |.:::. :...|.|.|   |
Human    78 IQASYFGTD-------------------KITRINIAGWKTDGK--WQRDMCNVLLQLEDIN---C 118

  Fly   129 V-VDWGNLSQNDYKSASMSIFDVGLTVAGIIMALEELRPNHFHRSNVTLAGYSLGAHAAGYAGAV 192
            : :||.|.|: :|..|..::..||..||..|..|  ::...:..|.|.|.|:|||||.||.||:.
Human   119 INLDWINGSR-EYIHAVNNLRVVGAEVAYFIDVL--MKKFEYSPSKVHLIGHSLGAHLAGEAGSR 180

  Fly   193 LEGQVEQIIGLDPAGPLF-SLPAEVAPKYRLDPGDAQFVQVLHTSGG------SLGTSLKCGHAD 250
            :.| :.:|.|||||||.| :.|.||    ||||.||.||.|:||:..      .:||...|||.|
Human   181 IPG-LGRITGLDPAGPFFHNTPKEV----RLDPSDANFVDVIHTNAARILFELGVGTIDACGHLD 240

  Fly   251 FYPNGGR---------APQTNCKMFANLRDMQNTNPVSCSHSAAAIFFRQS-MDPEYPFVGYECG 305
            ||||||:         .|.......|..::|.:.  ..|:|:.:..|:.:| ::|: .|:.|.|.
Human   241 FYPNGGKHMPGCEDLITPLLKFNFNAYKKEMASF--FDCNHARSYQFYAESILNPD-AFIAYPCR 302

  Fly   306 SYREFAAGYC----------DGNRKARFGIHSQRRAQGSFYF-RTAPQQPYVPRRQTNW------ 353
            ||..|.||.|          .|:...||...:. :..||.|| .|....|:     ..|      
Human   303 SYTSFKAGNCFFCSKEGCPTMGHFADRFHFKNM-KTNGSHYFLNTGSLSPF-----ARWRHKLSV 361

  Fly   354 -LSGVGRMSSSKVSQVSQSPLVLRL 377
             |||         |:|:|..:.||:
Human   362 KLSG---------SEVTQGTVFLRV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 98/303 (32%)
PNLIPRP3NP_001011709.2 Lipase 18..352 CDD:278576 112/374 (30%)
Pancreat_lipase_like 52..348 CDD:238363 106/345 (31%)
PLAT_PL 355..467 CDD:238857 9/32 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.