DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and LOC101884800

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_005174466.1 Gene:LOC101884800 / 101884800 -ID:- Length:530 Species:Danio rerio


Alignment Length:272 Identity:96/272 - (35%)
Similarity:125/272 - (45%) Gaps:34/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 LFLHGWNDQG-SKDWVQELLLTWTLFD--SNYNVCVVDWGNLSQNDYKSASMSIFDVGLTVAGII 158
            |.:|||:..| .:.||.:|:.  .|:|  .:.||.||||.:.:...|..::.:...||..||..:
Zfish    79 LIIHGWSVAGLFESWVYKLVT--ALYDREPSANVIVVDWLDRANKHYPKSAENTRLVGADVAKFV 141

  Fly   159 MALEELRPNHFHRSNVTLAGYSLGAHAAGYAGAVLEGQVEQIIGLDPAGPLFSLPAEVAPKYRLD 223
            ..||||   .:....|.|.|||||||.||.||.:...:|.:|.|||||||.|. .|::.  .||.
Zfish   142 NWLEEL---DYPLEKVHLLGYSLGAHVAGVAGNLTNNKVHRITGLDPAGPSFE-NADIL--RRLS 200

  Fly   224 PGDAQFVQVLHTS--GG---SLGTSLKCGHADFYPNGGRAPQTNC------KMFANLRDMQNTNP 277
            |.||.||.||||:  |.   |:|.....||.|.|||||.. |..|      |:.|..........
Zfish   201 PDDASFVDVLHTNTRGSPDLSIGIQRPVGHVDIYPNGGTF-QPGCSIQHTMKLIATCGIYNMDQI 264

  Fly   278 VSCSHSAAAIFFRQSM-DPEYPFVGYECGSYREFAAGYCDGNRKARFG--------IHSQRRAQG 333
            |.|||..:...|..|: :..|....:.|.|...|..|.|...||.|..        |.|.|..: 
Zfish   265 VKCSHERSIHLFIDSLVNQAYQSWAFRCASRDSFNKGLCLSCRKNRCNTLGYNVKKIRSTRSTK- 328

  Fly   334 SFYFRTAPQQPY 345
             .|.:|....|:
Zfish   329 -MYLKTREMMPF 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 95/266 (36%)
LOC101884800XP_005174466.1 lipo_lipase 35..473 CDD:132274 96/272 (35%)
Pancreat_lipase_like 39..335 CDD:238363 95/266 (36%)
PLAT 342..464 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.