DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and lpl

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_002934038.1 Gene:lpl / 100127862 XenbaseID:XB-GENE-951545 Length:483 Species:Xenopus tropicalis


Alignment Length:332 Identity:102/332 - (30%)
Similarity:142/332 - (42%) Gaps:61/332 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NSLERAHLNHGIVFECRTISAKDFG------------NEVHFNLQLGDLRGFRRLDPNKKLALFL 99
            ||:|..       |..||:...|..            ::.:||             ...|..:.:
 Frog    43 NSIESK-------FSLRTLEEPDDDTCYLVPGQEHTVDQCNFN-------------HTSKTFVVI 87

  Fly   100 HGWNDQGS-KDWVQELLLTWTLFDSNYNVCVVDWGNLSQNDYKSASMSIFDVGLTVAGIIMALEE 163
            |||...|. :.||.:|:......:.:.||.||||...:|..|..::.....||..||..|..:::
 Frog    88 HGWTVTGMFESWVPKLVDALYKREPDSNVIVVDWLTRAQQHYPVSAEYTQLVGQDVASFIDWMDD 152

  Fly   164 LRPNHFHRSNVTLAGYSLGAHAAGYAGAVLEGQVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQ 228
              ...:...|:.:.||||||||||.||::...:|.:|.|||||||.|.. ||.|  ..|.|.||:
 Frog   153 --TIQYPIDNIHILGYSLGAHAAGVAGSLTNKKVNRITGLDPAGPTFEY-AENA--IILSPDDAE 212

  Fly   229 FVQVLHT-----SGGSLGTSLKCGHADFYPNGGRAPQTNCKMFANLR--------DMQNTNPVSC 280
            ||.||||     ...|:|.....||.|.||||| :.|..|.:...||        |:...  |.|
 Frog   213 FVDVLHTYTRGSPDRSIGIQKPVGHIDIYPNGG-SFQPGCNLGEALRLIAEKGFGDVDQL--VKC 274

  Fly   281 SHSAAA-IFFRQSMDPEYPFVGYECGSYREFAAGYCDGNRKAR-----FGIHSQR-RAQGSFYFR 338
            ||..:. :|....:..|.|.:.|.|.|...|..|.|...||.|     :.::..| :.....|.:
 Frog   275 SHERSIHLFIDSLLYEEKPSMAYRCNSKEAFEKGLCLSCRKNRCNTLGYKVNKVRGKRSTKMYLK 339

  Fly   339 TAPQQPY 345
            |..|.|:
 Frog   340 TRAQMPF 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 94/306 (31%)
lplXP_002934038.1 lipo_lipase 41..476 CDD:132274 102/332 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.