DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1986 and lipib

DIOPT Version :9

Sequence 1:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_001342691.1 Gene:lipib / 100003046 ZFINID:ZDB-GENE-091118-47 Length:448 Species:Danio rerio


Alignment Length:315 Identity:96/315 - (30%)
Similarity:140/315 - (44%) Gaps:55/315 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RAHLNHGIVFEC-RTISAKDFGNEVHFNLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKD-WVQE 113
            ||:|      || :.:...:|..:..||:             .:.....:||:...|:.. |:..
Zfish    49 RANL------ECGQELPHHNFTQQPLFNV-------------TRPTTFVIHGYRPTGAPPIWINH 94

  Fly   114 L--LLTWTLFDSNYNVCVVDWGNLSQN-DYKSASMSIFDVGLTVAGIIMALEELRPNHFHRSNVT 175
            :  ||.   ...:.|:.||||...:.| :|.:|..:.....|.:...|.::|:   ......::.
Zfish    95 IVHLLA---AQKDMNILVVDWNRGAANLNYLTAVANTRGTALNITRFIESMEK---EGASLDSIH 153

  Fly   176 LAGYSLGAHAAGYAGAVLEGQVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSL 240
            |.|.|||||.||:.||:|.|:|.:|.|||||||:|   |.|:|:.||||.|||||.||||...|.
Zfish   154 LIGVSLGAHVAGFIGAMLGGRVGRITGLDPAGPMF---ASVSPEERLDPTDAQFVDVLHTDMNSF 215

  Fly   241 GTSLKCGHADFYPNGGRAPQTNC--KMFANLRDMQNTNPVSCSHSAAAIFFRQSMDPEYPFVGYE 303
            |.....||.|||.||| ..|..|  .:|:      ..:...|.|..:...:..|::......||.
Zfish   216 GLRGTHGHIDFYANGG-LDQPGCPKTIFS------GKSYFVCDHQRSVFLYLCSLNRTCSLTGYP 273

  Fly   304 CGSYREFAAGYC-------------DGNRKARFGIHSQRRAQGSFYFRTAPQQPY 345
            |.||.:|.:|.|             .|...:::.....|..|...||.|..:.||
Zfish   274 CSSYSDFLSGQCLQCETFKPASCPVLGYDLSQWRDTLLRLGQTRAYFSTTAELPY 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 89/292 (30%)
lipibXP_001342691.1 Lipase 37..328 CDD:278576 94/313 (30%)
Pancreat_lipase_like 40..324 CDD:238363 94/309 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.