DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment H2bc1 and His2B:CG33868

DIOPT Version :9

Sequence 1:NP_783594.1 Gene:H2bc1 / 319177 MGIID:2448375 Length:127 Species:Mus musculus
Sequence 2:NP_001027385.1 Gene:His2B:CG33868 / 3772265 FlyBaseID:FBgn0053868 Length:123 Species:Drosophila melanogaster


Alignment Length:126 Identity:102/126 - (80%)
Similarity:110/126 - (87%) Gaps:5/126 - (3%)


- Green bases have known domain annotations that are detailed below.


Mouse     2 PEVAVKGATISKKGFKKAVTKTQKKEGRKRKRCRKESYSIYIYKVLKQVHPDTGISSKAMSIMNS 66
            |:.:.|.|..:.|. :|.:|||.|    |:||.|||||:||||||||||||||||||||||||||
  Fly     3 PKTSGKAAKKAGKA-QKNITKTDK----KKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIMNS 62

Mouse    67 FVTDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 127
            ||.|||||||:||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    63 FVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
H2bc1NP_783594.1 H2B 29..125 CDD:197718 89/95 (94%)
His2B:CG33868NP_001027385.1 H2B 33..121 CDD:197718 84/87 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 143 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG1744
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I3859
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53922
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000065
OrthoInspector 1 1.000 - - otm42638
orthoMCL 1 0.900 - - OOG6_100082
Panther 1 1.100 - - O PTHR23428
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X77
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.