DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and prss60.1

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:280 Identity:93/280 - (33%)
Similarity:132/280 - (47%) Gaps:41/280 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CGSA-FSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLT 187
            ||.| .:.|:|||.|.....:||...| :..:.||  :.||.|.|...|:||||||:..:..:..
Zfish    25 CGLAPLNNRIVGGVNAFDGSWPWQVSL-HSPIYGG--HFCGGSLINSEWVLTAAHCLPRITTSSL 86

  Fly   188 AAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYRNDIALLRLSRPVNWLQ 252
            ...||:..:          .||...   .|..|:..|..|..|:.|...||||||.||..|.:  
Zfish    87 LVFLGKTTQ----------QGVNTY---EINRTVSVITVHPSYNNLTNENDIALLHLSSAVTF-- 136

  Fly   253 MQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTE---SSGSSKIKQKAMLHIQPQDQCQEAFYKD 314
            ...:.||||..|...:.|   |:::.::|||..:   :..:..|.|:.|:.:.|.||| .|....
Zfish   137 SNYIRPVCLAAQNSVFPN---GTSSWITGWGNIQLGVNLPAPGILQETMIPVVPNDQC-NALLGS 197

  Fly   315 TKITLADSQMCAG---GEIGVDSCSGDSGGPLTVEANTASGNRYVYL-AGVVSIGRKHCGTALFS 375
            ..:|  ::.:|||   |  |.|:|.||||||:      .|....|:: :|:.|.| ..|......
Zfish   198 GSVT--NNMICAGLLQG--GRDTCQGDSGGPM------VSKQCLVWVQSGITSWG-YGCADPYSP 251

  Fly   376 GIYTRVSSYMDWIESTIRAN 395
            |:|||||.|..||.|.|..|
Zfish   252 GVYTRVSQYQSWINSIIVQN 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 85/263 (32%)
Tryp_SPc 133..391 CDD:238113 86/264 (33%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 85/263 (32%)
Tryp_SPc 34..267 CDD:238113 86/265 (32%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.