DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser7 and Prss8

DIOPT Version :9

Sequence 1:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:293 Identity:85/293 - (29%)
Similarity:130/293 - (44%) Gaps:54/293 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 SGIDQLPEHPYCGSAFSFRLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAH 177
            |||........||:....|:.||.:....::||...:.|:     .::.||.|.::.:|:::|||
Mouse    26 SGIRADGTEASCGAVIQPRITGGGSAKPGQWPWQVSITYD-----GNHVCGGSLVSNKWVVSAAH 85

  Fly   178 CI---HTMGR---NLTAAILGEWNRDTDPDCENDLNGVRECAPPHIRVTIDRILPHAQYSELNYR 236
            |.   |:...   .|.|..|..::.||                  :..|:.:|:.|:.|.|...:
Mouse    86 CFPREHSREAYEVKLGAHQLDSYSNDT------------------VVHTVAQIITHSSYREEGSQ 132

  Fly   237 NDIALLRLSRPVNWLQMQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSSKIK---QKAM 298
            .||||:|||.||.:  .:.:.|:|||.....:.|   |....|:|||....|.|.:..   |:..
Mouse   133 GDIALIRLSSPVTF--SRYIRPICLPAANASFPN---GLHCTVTGWGHVAPSVSLQTPRPLQQLE 192

  Fly   299 LHIQPQDQCQEAFYKDTKI-----TLADSQMCAG---GEIGVDSCSGDSGGPLTVEANTASGNRY 355
            :.:..::.| ...|....:     |:....:|||   |  |.|:|.|||||||:...     ...
Mouse   193 VPLISRETC-SCLYNINAVPEEPHTIQQDMLCAGYVKG--GKDACQGDSGGPLSCPM-----EGI 249

  Fly   356 VYLAGVVSIGRKHCGTALFSGIYTRVSSYMDWI 388
            .||||:||.| ..||.....|:||..|:|..||
Mouse   250 WYLAGIVSWG-DACGAPNRPGVYTLTSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 78/273 (29%)
Tryp_SPc 133..391 CDD:238113 79/273 (29%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 79/274 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.